CD23 Monoclonal antibody, PBS Only (Capture)

CD23 Monoclonal Antibody for WB, IHC, IF-P, Cytometric bead array, Indirect ELISA
Cat No. 60208-2-PBS
Clone No.4C7C9

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse

Applications

WB, IHC, IF-P, Cytometric bead array, Indirect ELISA

C-type lectin domain family 4 member J, CLEC4J, CD23A, BLAST-2, BLAST 2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

60208-2-PBS targets CD23 as part of a matched antibody pair:

MP50220-1: 60208-2-PBS capture and 60208-3-PBS detection (validated in Cytometric bead array)

MP50220-2: 60208-2-PBS capture and 60208-4-PBS detection (validated in Cytometric bead array)

MP50220-3: 60208-2-PBS capture and 60208-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag0425

Product name: Recombinant human CD23,FCER2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 48-248 aa of BC064417

Sequence: DTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPG

Predict reactive species
Full Name Fc fragment of IgE, low affinity II, receptor for (CD23)
Calculated Molecular Weight 321 aa, 36 kDa
Observed Molecular Weight 40 kDa
GenBank Accession NumberBC064417
Gene Symbol CD23
Gene ID (NCBI) 2208
RRIDAB_11232221
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP06734
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CD23, also known as low affinity immunoglobulin epsilon Fc receptor, is a transmembrane glycoprotein present on a subpopulation of B lymphocytes in germinal centres, EBV-transformed B-lymphoblastoid cell lines, follicular dendritic cells, and a subpopulation of peripheral blood cells. CD23 has essential roles in the regulation of IgE production and in the differentiation of B-cells.

Loading...
||
New chat Able
正在加载,请稍候...