CD244 Polyclonal antibody

• 

  WB analysis of NK-92 using 16677-1-AP

  NK-92 cells were subjected to SDS PAGE followed by western blot with 16677-1-AP (CD244 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

CD244 Polyclonal Antibody for WB, ELISA

Cat No. 16677-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IF, IHC, ELISA

Synonyms

2B4, CD244, h2B4, NAIL, NKR2B4, SLAMF4

---

Tested Applications

• Positive WB detected in: NK-92 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

16677-1-AP targets CD244 in WB, IF, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9860

  Product name: Recombinant human CD244 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 21-220 aa of BC053985

  Sequence: GCQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWENGSLPSNTSNDRFSFIVKNLSLLIKAAQQQDSGLYCLEVTSISGKVQTATFQVFVFDKVEKPRLQGQGKILDRGRCQVALSCLVSRDGNVSYAWYRGSKLIQTAGNLTYLDEEVDINGTHTYTCNVSNPVSWESHTLNLTQDCQNAHQEF

• Full Name: CD244 molecule, natural killer cell receptor 2B4
• Calculated Molecular Weight: 365 aa, 41 kDa
• Observed Molecular Weight: 60-70 kDa
• GenBank Accession Number: BC053985
• Gene Symbol: CD244
• Gene ID (NCBI): 51744
• RRID: AB_2878297
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BZW8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD244, also known as SLAMF4 or 2B4, is a type I transmembrane glycoprotein belonging to the signaling lymphocyte activation molecule (SLAM) family. It consists of an extracellular segment with two immunoglobulin (Ig)-like domains, a transmembrane region, and a cytoplasmic domain containing tyrosine-based motifs (PMID: 9841922; 30546369). CD244 is present on natural killer (NK) cells, γδ T cells, a subset of CD8+ T cells, monocytes, basophils, dendritic cells, and myeloid-derived suppressor cells (MDSCs) (PMID: 30546369). It binds to CD48 with high affinity and transmits stimulatory or inhibitory signals that regulate immune function (PMID: 9841922; 18523281).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Nat Med; A case report of clonal EBV-like memory CD4+ T cell activation in fatal checkpoint inhibitor-induced encephalitis.; Authors - Douglas B Johnson
pig	IF	Nat Commun; Pluripotency and X chromosome dynamics revealed in pig pre-gastrulating embryos by single cell analysis.; Authors - Priscila Ramos-Ibeas