Product Information
60797-5-PBS targets CD247 as part of a matched antibody pair:
MP51145-4: 60797-5-PBS capture and 60797-2-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag33870 Product name: Recombinant human CD247 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 50-164 aa of BC025703 Sequence: FLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR Predict reactive species |
| Full Name | CD247 molecule |
| Calculated Molecular Weight | 16 kDa |
| GenBank Accession Number | BC025703 |
| Gene Symbol | CD247 |
| Gene ID (NCBI) | 919 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P20963 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |

