CD28 Recombinant monoclonal antibody, PBS Only

• 

CD28 Uni-rAb^® Recombinant Antibody for Sandwich ELISA, Indirect ELISA

Cat No. 83032-1-PBS

Clone No.230276C11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA

Synonyms

CD28 molecule, T-cell-specific surface glycoprotein CD28, Tp44

---

Product Information

83032-1-PBS targets CD28 in Sandwich ELISA, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Affinity:
  K_D=7.10 x 10^-10M
  K_Off=1.85 x 10^-4M
  K_On=2.61 x 10^5M
• Immunogen:

  CatNo: Ag15942

  Product name: Recombinant human CD28 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 19-153 aa of BC093698

  Sequence: NKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPF

• Full Name: CD28 molecule
• Calculated Molecular Weight: 220 aa, 25 kDa
• GenBank Accession Number: BC093698
• Gene Symbol: CD28
• Gene ID (NCBI): 940
• ENSEMBL Gene ID: ENSG00000178562
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P10747
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.