CD28 Recombinant monoclonal antibody, PBS Only

• 

  Affinity and Kinetic Characterization of 83383-5-PBS

  Biolayer interferometry (BLl) kinetic assay of 83383-5-PBS against Human CD28 was performed. The affinity constant is 0.84 nM.

CD28 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Indirect ELISA

Cat No. 83383-5-PBS

Clone No.240354G12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Synonyms

CD28 molecule, T-cell-specific surface glycoprotein CD28, Tp44

---

Product Information

83383-5-PBS targets CD28 in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0889

  Product name: Recombinant Human CD28 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 19-152 aa of BC093698

  Sequence: NKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP

• Full Name: CD28 molecule
• Calculated Molecular Weight: 220 aa, 25 kDa
• GenBank Accession Number: BC093698
• Gene Symbol: CD28
• Gene ID (NCBI): 940
• ENSEMBL Gene ID: ENSG00000178562
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P10747
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.