CD2BP2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CD2BP2 Polyclonal antibody (32930-1-AP)

• 

  WB analysis using 32930-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32930-1-AP (CD2BP2 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

CD2BP2 Polyclonal Antibody for WB, ELISA

Cat No. 32930-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Synonyms

CD2 antigen cytoplasmic tail-binding protein 2, CD2 cytoplasmic domain-binding protein 2, CD2 Cytoplasmic Tail Binding Protein 2, CD2 tail-binding protein 2, KIAA1178

---

Tested Applications

• Positive WB detected in: A549 cells, HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32930-1-AP targets CD2BP2 in applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38662

  Product name: Recombinant human CD2BP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 250-341 aa of NM_001243646.1

  Sequence: MFAEELAEEELETPTPTQRGEAESRGDGLVDVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT*

• Full Name: CD2 (cytoplasmic tail) binding protein 2
• Calculated Molecular Weight: 38kDa，341aa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: NM_001243646.1
• Gene Symbol: CD2BP2
• Gene ID (NCBI): 10421
• RRID: AB_3742794
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: O95400
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD2BP2 (CD2-binding protein 2) is a multifunctional protein that was initially identified as a binding partner of the T-cell surface antigen CD2. It binds to the cytoplasmic tail of CD2 through its C-terminal GYF domain in the cytoplasm, regulating CD2-mediated T-lymphocyte activation. Additionally, CD2BP2 is a component of the U5 small nuclear ribonucleoprotein complex (snRNP), participating in the RNA splicing process. Studies have shown that CD2BP2 plays a crucial role in embryonic development; its absence leads to delayed embryonic growth, vascularization defects, and death by embryonic day 10.5. Specific depletion of CD2BP2 in renal podocytes results in proteinuria and ultimately fatal renal failure.