• Featured Product
  • KD/KO Validated

CoraLite® Plus 647-conjugated CD3 Monoclonal antibody

CD3 Monoclonal Antibody for IF/ICC, IF-P

Cat No. CL647-60181
Clone No.3F3A1

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

IF/ICC, IF-P

CD3E, T-cell surface antigen T3/Leu-4 epsilon chain, T3E, CD3-epsilon, CD3 epsilon

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inhuman colon cancer tissue, human tonsillitis tissue, human liver cancer tissue
Positive IF/ICC detected inJurkat cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL647-60181 targets CD3 in IF/ICC, IF-P applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag11797

Product name: Recombinant human CD3E protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-207 aa of BC049847

Sequence: MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI

Predict reactive species
Full Name CD3e molecule, epsilon (CD3-TCR complex)
Calculated Molecular Weight 207 aa, 23 kDa
Observed Molecular Weight 23 kDa
GenBank Accession NumberBC049847
Gene Symbol CD3
Gene ID (NCBI) 916
ENSEMBL Gene IDENSG00000198851
RRIDAB_2920243
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
Excitation LaserRed Laser (633 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP07766
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

CD3 is a complex of proteins that directly associates with the T cell receptor (TCR). The TCR/CD3 complex of T-lymphocytes consists of either a TCR alpha/beta or TCR gamma/delta heterodimer coexpressed at the cell surface with the invariant subunits of CD3 labeled gamma, delta, epsilon, zeta, and eta. The TCR recognizes antigens bound to major histocompatibility complex (MHC) molecules. TCR-mediated peptide-MHC recognition is transmitted to the CD3 complex, leading to the intracellular signal transduction. CD3 is considered to be a pan-T cell marker for detection of normal and neoplastic T cells. This anti-CD3 is a monoclonal antibody directed against the epsilon chain of human CD3 molecule.

Protocols

Product Specific Protocols
IF protocol for CL Plus 647 CD3 antibody CL647-60181Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...