CD3E Fusion Protein

Catalog number: Ag11797

Be the first to review this product


$199.00€199.00£199.00

Freight/Packing £00.00

Size: 09µ/gram

Format: Liquid

Please visit your regions distributor:


You can also
Request A Quote

Images See all

CD3E fusion protein Ag11797 SDS-PAGE


Product Name:
human CD3E-6*His fusion protein

Catalog No:
Ag11797

Source:
E. coli-derived, PET28a

Peptide Sequence:
MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
(1-207 aa encoded by BC049847)

Activity:
Not tested.

Endotoxin Level:
Please contact the lab for more information.

Back
to top