Product Information
87861-1-PBS targets CD3 gamma in WB, IHC, Indirect ELISA applications and shows reactivity with mouse samples.
| Tested Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg1402 Product name: Recombinant mouse CD3 gamma protein Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 23-116 aa of NM_009850.2 Sequence: QTNKAKNLVQVDGSRGDGSVLLTCGLTDKTIKWLKDGSIISPLNATKNTWNLGNNAKDPRGTYQCQGAKETSNPLQVYYRMCENCIELNIGTIS Predict reactive species |
| Full Name | CD3 antigen, gamma polypeptide |
| Calculated Molecular Weight | 20 kDa |
| Observed Molecular Weight | 20 kDa |
| GenBank Accession Number | NM_009850.2 |
| Gene Symbol | Cd3g |
| Gene ID (NCBI) | 12502 |
| RRID | AB_3745795 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P11942 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
CD3 is a complex of proteins that directly associates with the T cell receptor (TCR). The TCR/CD3 complex of T-lymphocytes consists of either a TCR alpha/beta or TCR gamma/delta heterodimer coexpressed at the cell surface with the invariant subunits of CD3 labeled gamma, delta, epsilon, zeta, and eta. The TCR recognizes antigens bound to major histocompatibility complex (MHC) molecules. TCR-mediated peptide-MHC recognition is transmitted to the CD3 complex, leading to the intracellular signal transduction. CD3 is considered to be a pan-T cell marker for detection of normal and neoplastic T cells.







