Product Information
30798-1-PBS targets CD300LD in WB, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag29307 Product name: Recombinant human CD300LD protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 122-194 aa of NM_001115152 Sequence: VTINPGTQTAVSEWTTTTASLAFTAAATQKTSSPLTRSPLKSTHFLFLFLLELPLLLSMLGTVLWVNRPQRRS Predict reactive species |
| Full Name | CD300 molecule-like family member d |
| Calculated Molecular Weight | 22 kDa |
| Observed Molecular Weight | 40-43 kDa |
| GenBank Accession Number | NM_001115152 |
| Gene Symbol | CD300LD |
| Gene ID (NCBI) | 100131439 |
| RRID | AB_3669758 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q6UXZ3 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
CD300LD, also known as CD300D and CMRF35A4, is a member of the CD300 family. The CD300 family of molecules modulates a broad and diverse range of immune cell processes via their paired activating and inhibitory receptor functions. CD300LD is a 194 amino acid single-pass type I membrane protein containing an Ig-like V-type (immunoglobulin-like) domain. The apparent molecular weight is greater than the calculated molecular weight of 22 kDa, probably due to post-translational modification, presumably by glycosylation.



