Mouse CD302 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of rat liver using 85813-5-RR (same clone as 85813-5-PBS)

  Rat liver tissue was subjected to SDS PAGE, followed by western blot with 85813-5-RR (Cd302 antibody) at a dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85813-5-PBS in a different storage buffer formulation.

• 

  WB analysis using 85813-5-RR (same clone as 85813-5-PBS)

  Mouse liver tissue was subjected to SDS PAGE followed by western blot with 85813-5-RR (Cd302 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85813-5-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 85813-5-RR (same clone as 85813-5-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 85813-5-RR (CD302 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85813-5-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 85813-5-RR (same clone as 85813-5-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 85813-5-RR (CD302 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85813-5-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse spleen using 85813-5-RR (same clone as 85813-5-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 85813-5-RR (CD302 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85813-5-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse spleen using 85813-5-RR (same clone as 85813-5-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 85813-5-RR (CD302 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85813-5-PBS in a different storage buffer formulation.

CD302 Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 85813-5-PBS

Clone No.242893D7

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

CD302 antigen, Clec13a, C-type lectin domain family 13 member A, Type I transmembrane C-type lectin receptor DCL-1

---

Product Information

85813-5-PBS targets CD302 in WB, IHC, Indirect ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2660

  Product name: Recombinant Mouse CD302 protein (rFc Tag) (HPLC verified)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 21-156 aa of NM_025422.4

  Sequence: DCPSSTWVQFQGSCYAFLQVTINVENIEDVRKQCTDHGADMVSIHNEEENAFILDTLQKRWKGPDDLLLGMFYDTDDATFKWYDHSNMTFDKWADQDGEDLVDTCGFLYTKTGEWRKGDCEISSVEGTLCKAANNH

• Full Name: CD302 antigen
• Calculated Molecular Weight: 24 kDa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: NM_025422.4
• Gene Symbol: Cd302
• Gene ID (NCBI): 66205
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9DCG2-2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CD302 is a C-type lectin receptor involved in cell adhesion and migration, as well as endocytosis and phagocytosis. In mice and humans, CD302 is primarily expressed in the liver, lungs, lymph nodes (LNs), spleen, and bone marrow. In CD302 gene knockout (CD302KO) mice, the migration frequency and number of myeloid dendritic cells (mDC) in CD302KO lymph nodes were reduced compared to the wild type, confirming the functional role of CD302 in mDC migration.