Tested Applications
| Positive WB detected in | human peripheral blood platelets, MOLT-4 cells, Jurkat cells |
| Positive IHC detected in | human tonsillitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HUVEC cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
80530-1-RR targets CD31 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag1787 Product name: Recombinant human CD31 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 428-738 aa of BC022512 Sequence: EVRCESISGTLPISYQLLKTSKVLENSTKNSNDPAVFKDNPTEDVEYQCVADNCHSHAKMLSEVLRVKVIAPVDEVQISILSSKVVESGEDIVLQCAVNEGSGPITYKFYREKEGKPFYQMTSNATQAFWTKQKANKEQEGEYYCTAFNRANHASSVPRSKILTVRVILAPWKKGLIAVVIIGVIIALLIIAAKCYFLRKAKAKQMPVEMSRPAVPLLNSNNEKMSDPNMEANSHYGHNDDVGNHAMKPINDNKEPLNSDVQYTEVQVSSAESHKDLGKKDTETVYSEVRKAVPDAVESRYSRTEGSLDGT Predict reactive species |
| Full Name | platelet/endothelial cell adhesion molecule |
| Calculated Molecular Weight | 83 kDa |
| Observed Molecular Weight | 130 kDa |
| GenBank Accession Number | BC022512 |
| Gene Symbol | CD31 |
| Gene ID (NCBI) | 5175 |
| ENSEMBL Gene ID | ENSG00000261371 |
| RRID | AB_2918900 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P16284 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Platelet endothelial cell adhesion molecule-1 (PECAM-1, CD31) is a member of the immunoglobulin gene superfamily of cell adhesion molecules. CD31 is a transmembrane glycoprotein that is highly expressed on the surface of the endothelium, making up a large portion of its intracellular junctions. PECAM-1 is also present on the surface of hematopoietic cells and immune cells including platelets, monocytes, neutrophils, natural killer cells, megakaryocytes and some types of T-cell (PMID: 9011572). As well as its role in cell-cell adhesion, PECAM-1 functions as a signaling receptor, and is involved in important physiological events such as nitric oxide production, regulation of T-cell immunity and tolerance, leukocyte transendothelial migration and inflammation and angiogenesis (PMID: 21183735; 20978210; 17872453; 20634489).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CD31 antibody 80530-1-RR | Download protocol |
| IHC protocol for CD31 antibody 80530-1-RR | Download protocol |
| WB protocol for CD31 antibody 80530-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
CD31 Recombinant monoclonal antibody (4N13), catalog number 80530-1-RR, has 15 citations spanning journals including Bioactive Materials, Gut Microbes, Phytomedicine, Materials Today Bio, Oncogene, Apoptosis, ACS Applied Materials & Interfaces, Frontiers in Immunology, Biomaterials Advances, Ecotoxicology and Environmental Safety, Cell Molecular Life Sciences, BBA Molecular Basis of Disease, Functional & Integrative Genomics, and International Urology and Nephrology. Research fields cover bone regeneration, wound healing, oncology, neurovascular injury, sepsis, atherosclerosis, and pulmonary fibrosis.
| Species | Application | Title |
|---|---|---|
Bioact Mater Sequential simulation of regeneration-specific microenvironments using scaffolds loaded with nanoplatelet vesicles enhances bone regeneration | ||
Gut Microbes Resveratrol amplifies the anti-tumor effect of α-PD-1 by altering the intestinal microbiome and PGD2 content | ||
Phytomedicine Safranal accelerates diabetic wound healing by suppressing ferroptosis through modulation of transcription factor Forkhead Box O3. | ||
Mater Today Bio 4'-hydroxychalcone nanofiber hydrogel dressing promotes diabetic chronic wound healing by regulating macrophage polarization via the TLR/IL-17/TNF signaling pathway. | ||
Mater Today Bio Photocontrolled biomimetic PEEK scaffold with black phosphorus-strontium ion cascade release for vascularized bone regeneration. | ||
Oncogene Upconversion mesoporous silica nanoparticles co-delivering celecoxib and rose bengal enable multimodal immunogenic and anti-angiogenic therapy for spinal metastasis of non-small cell lung cancer. |
Reviews
What customers say
One reviewer (Alessandra Milesi, May 2023) rated this antibody 4 out of 5 stars after testing it for immunofluorescence on umbilical cord tissue. While the antibody performed adequately during initial trials, the reviewer ultimately decided it was not suitable for their specific application and replaced CD31 staining with a different antibody combination in their final protocol. No dilution details were provided.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
alessandra (Verified Customer) (05-11-2023) | dopo le prove non abbiamo ritenuto utile eseguire l'IF con CD31, che abbiamo sostituito con una doppia con altro anticorpo
 |
