Anti-Rat CD31 Rabbit Recombinant Antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• Anti-Rat CD31 Rabbit Recombinant Antibody, PBS Only (98457-1-PBS)

CD31 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98457-1-PBS Copied!

Clone No. 250372H6

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

rat

Applications

FC

Synonyms

Pecam, Pecam1, PECAM-1, Platelet endothelial cell adhesion molecule

• 

  FC experiment of rat splenocytes using 98457-1-RR (same clone as 98457-1-PBS)

  1x10^6 rat splenocytes were surface stained with 0.25 ug Anti-Rat CD31 Rabbit RecAb (98457-1-RR, Clone: 250372H6) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were then stained with CoraLite® Plus 647 Anti-Rat CD45RA (OX-33) Mouse IgG2a Recombinant Antibody (CL647-65578, Clone: OX-33). Cells were not fixed. This data was developed using the same antibody clone with 98457-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of rat splenocytes using 98457-1-RR (same clone as 98457-1-PBS)

  1x10^6 rat splenocytes were surface stained with 0.25 ug Anti-Rat CD31 Rabbit RecAb (98457-1-RR, Clone: 250372H6) (red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed. This data was developed using the same antibody clone with 98457-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CD31 in ?

Chat with Able

---

Product Information

98457-1-PBS targets CD31 in FC applications and shows reactivity with rat samples.

• Tested Reactivity: rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1456

  Product name: Recombinant Rat CD31/PECAM-1 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 18-589 aa of NP_113779.1

  Sequence: QENSFTINSIHMESRPSWEVSNGQKLTLQCLVDISTTSKSRPQHQVLFYKDDALVYNVSSSEHTESFVIPQSRVFHAGKYKCTVILNSKEKTTIEYQLTVNGVPMPEVTVDKKEVTEGGIVTVNCSMQEEKPPIYFKIEKVELGTKNVKLSREKTSNMNFVLIEFPIEEQDHLLVFRCQAGVLSGIKMQTSEFIRSEYVTVQEFFSTPKFQIQPPEMIIEGNQLHIKCSVQVAHLAQEFPEIIIQKDKAIVATSKQSKEAVYSVMALVEHSGHYTCKVESNRISKASSILVNITELFPRPKLELSSSRLDQGEMLDLSCSVSGAPVANFTIQKEETVLSQYQNFSKIAEERDSGLYSCTAGIGKVVKRSNLVPVQVCEMLSKPRIFHDAKFEIIKGQIIGISCQSVNGTAPITYRLLRAKSNFQTVQKNSNDPVTFTDKPTRDMEYQCIVDNCHSHPEVRSEILRVKVIAPVDEVTISILSGNDVQSGDEMVLRCSVKEGTGPVTFQFYKEKEGRPFHEETVNDTQVFWHHEQTSKEQEGQYYCTAFNRASIVTSLRSGPLTVRVFLAPWKK

• Full Name: platelet/endothelial cell adhesion molecule 1
• Calculated Molecular Weight: 76kDa
• GenBank Accession Number: NP_113779.1
• Gene Symbol: Pecam1
• Gene ID (NCBI): 29583
• RRID: AB_3746086
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q3SWT0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CD31, also known as PECAM1 (Platelet endothelial cell adhesion molecule), is a member of the immunoglobulin gene superfamily of cell adhesion molecules. CD31 is a transmembrane glycoprotein that is highly expressed on the surface of the endothelium, making up a large portion of its intracellular junctions. It is also present on the surface of hematopoietic cells and immune cells including platelets, monocytes, neutrophils, natural killer cells, megakaryocytes and some types of T-cell (PMID: 9011572). As well as its role in cell-cell adhesion, CD31 functions as a signaling receptor, and is involved in important physiological events such as nitric oxide production, regulation of T-cell immunity and tolerance, leukocyte transendothelial migration and inflammation and angiogenesis (PMID: 21183735; 20978210; 17872453; 20634489).