CD320 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  WB analysis of HeLa using 83574-3-RR (same clone as 83574-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83574-3-RR (CD320 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83574-3-PBS in a different storage buffer formulation.

• 

  Cytometric bead array standard curve of MP00564-3

  Cytometric bead array standard curve of MP00564-3, CD320 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 83574-3-PBS. Detection antibody: 83574-2-PBS. Standard: Ag21445. Range: 1.25-40 ng/mL.

• 

  Affinity and Kinetic Characterization of 83574-3-RR

  Biolayer interferometry (BLl) kinetic assays of 83574-3-RR against Human CD320 were performed. The affinity constant is 6.55 nM.

CD320 Uni-rAb^® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA

Cat No. 83574-3-PBS

Clone No.240500D4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Cytometric bead array, Indirect ELISA

Synonyms

240500D4, 8D6, 8D6A, FDC-signaling molecule 8D6, FDC-SM-8D6

---

Product Information

83574-3-PBS targets CD320 as part of a matched antibody pair:

MP00564-3: 83574-3-PBS capture and 83574-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag21445

  Product name: Recombinant human CD320 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 36-229 aa of BC000668

  Sequence: SPLSTPTSAQAAGPSSGSCPPTKFQCRTSGLCVPLTWRCDRDLDCSDGSDEEECRIEPCTQKGQCPPPPGLPCPCTGVSDCSGGTDKKLRNCSRLACLAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTNEILPEGDATTMGPPVTLESVTSLRNATTMGPPVTLESVPSVGNATSSSAGDQSGSPTAY

• Full Name: CD320 molecule
• Calculated Molecular Weight: 29 kDa
• GenBank Accession Number: BC000668
• Gene Symbol: CD320
• Gene ID (NCBI): 51293
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9NPF0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CD320, also known as 8D6, 8D6A or TCblR, is a single-pass type I membrane protein containing 2 LDL-receptor class A domains. Expressed abundantly on follicular dendritic cells (FDCs), CD320 has been shown to enhance proliferation of germinal center (GC) B cells. It is the receptor for cellular uptake of transcobalamin-bound cobalamin. Defects in CD320 are the cause of methylmalonic aciduria type TCblR (MMATC). CD320 has a calculated molecular mass of 29 kDa. This antibody raised against 84-280aa of human CD320 protein detects bands at 58 kDa and 60-70 kDa. The aberrant mobility of the protein by SDS-PAGE is probably caused by extensive complex glycosylation (PMID: 18779389; 23415653).