CD33 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of THP-1 using 84341-3-RR (same clone as 84341-3-PBS)

  WB result of CD33 antibody (84341-3-RR; 1:100000; incubated at room temperature for 1.5 hours) with sh-Control and sh-CD33 transfected THP-1 cells. This data was developed using the same antibody clone with 84341-3-PBS in a different storage buffer formulation.

• 

  WB analysis using 84341-3-RR (same clone as 84341-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84341-3-RR (CD33 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84341-3-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 84341-3-RR (same clone as 84341-3-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 84341-3-RR (CD33 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84341-3-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 84341-3-RR (same clone as 84341-3-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 84341-3-RR (CD33 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84341-3-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

CD33 Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 84341-3-PBS

Clone No.241711D2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

241711D2, CD33 molecule, gp67, p67, Sialic acid-binding Ig-like lectin 3

---

Product Information

84341-3-PBS targets CD33 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2138

  Product name: Recombinant Human CD33 protein (rFc Tag) (HPLC verified)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 18-259 aa of BC028152

  Sequence: DPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISGDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVH

• Full Name: CD33 molecule
• Calculated Molecular Weight: 364 aa, 40 kDa
• Observed Molecular Weight: 55-75 kDa
• GenBank Accession Number: BC028152
• Gene Symbol: CD33
• Gene ID (NCBI): 945
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P20138
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CD33, also referred to as Siglec-3, is a 67-kDa glycosylated transmembrane protein of sialic acid-binding immunoglobulin-like lactic (siglec) family. CD33 is expressed on monocytes, myeloid progenitors, granulocytes, mast cells, some T cells. It may mediate cell-to-cell adhesion and act as a receptor that inhibits the proliferation of normal and leukemic myeloid cells.