CD36 Recombinant monoclonal antibody, PBS Only

CD36 Uni-rAb® Recombinant Antibody for WB, IHC, IF-P, Indirect ELISA
Cat No. 84078-4-PBS
Clone No.241262F5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF-P, Indirect ELISA

241262F5, Glycoprotein IIIb, GP3B, GP4, GPIIIB

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84078-4-PBS targets CD36 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg1070

Product name: Recombinant Human CD36/SR-B3 protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 30-439 aa of NM_001001548.3

Sequence: GDLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRFVLPSKAFASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETGTIGDEKANMFRSQVTGKIN

Predict reactive species
Full Name CD36 molecule (thrombospondin receptor)
Calculated Molecular Weight53 kDa
Observed Molecular Weight75-85 kDa
GenBank Accession NumberNM_001001548.3
Gene Symbol CD36
Gene ID (NCBI) 948
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP16671-1
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Function

CD36, also known as platelet glycoprotein 4, is an integral membrane glycoprotein that acts as a scavenger receptor. CD36 can bind to multiple ligands, including thrombospondin-1, collagen, oxidized phospholipids, oxidized low-density lipoprotein, and long-chain fatty acids. CD36 can also bind to erythrocytes parasitized by Plasmodium falciparum and apoptotic cells. CD36 mediates different biological processes, acting as a signaling hub in angiogenesis, inflammatory response, and fatty acid metabolism.

Tissue specificity

CD36 is present on the surface of various cells types, such as adipocytes, monocytes, macrophages, platelets, microvascular endothelial cells, dendritic cells, and hematopoietic precursors of red cells.

Involvement in disease
  • Mutations in CD36 can give rise to platelet glycoprotein IV deficiency, a type of macrothrombocytopenia.

  • Polymorphisms in CD36 can increase susceptibility to malaria.

  • AAGIC haplotype at the CD36 locus increases the risk of coronary heart disease.

  • Disruption of CD36-dependent pathways and certain SNPs in the CD36 gene are attributed to impaired fatty acid metabolism, glucose intolerance, Alzheimer's disease, atherosclerosis, arterial hypertension, diabetes, and cardiomyopathy.

Isoforms

Apart from the full-length protein (isoform 1), one additional shorter isoform has been reported (PMID: 7509795). Other alternative isoforms have also been detected on the mRNA level (PMID: 17673938).

Post-translational modifications

The extracellular domain of CD36 is extensively glycosylated. Glycosylation is needed for the transport of CD36 to the plasma membrane, as well as mediating recognition and binding to ligands. Cytoplasmic tails of transmembrane domains can be phosphorylated and play a role in signal transduction. Intracellular domains can be additionally acetylated, ubiquitinated, and palmitoylated (PMID: 28919632).

Cellular localization

CD36 is present on the cell surface.  

Loading...
||
New chat

Able

正在加载,请稍候...