CoraLite®594-conjugated CD36 Monoclonal antibody

CD36 Monoclonal Antibody for

Cat No. CL594-66395
Clone No.1A8C5

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

CD36, CHDS7, FAT, Fatty acid translocase, Glycoprotein IIIb, GP3B, GP4, GPIIIB, GPIV, PAS 4, PAS IV, PASIV, Platelet collagen receptor, Platelet glycoprotein 4, Platelet glycoprotein IV, SCARB3, Thrombospondin receptor

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite®594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

CL594-66395 targets CD36 in applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag13541

Product name: Recombinant human CD36 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-472 aa of BC008406

Sequence: MGCDRNCGLIAGAVIGAVLAVFGGILMPVGDLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRFVLPSKAFASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETGTIGDEKANMFRSQVTGKINLLGLIEMILLSVGVVMFVAFMISYCACRSKTIK

Predict reactive species
Full Name CD36 molecule (thrombospondin receptor)
Calculated Molecular Weight 472 aa, 53 kDa
Observed Molecular Weight 88 kDa
GenBank Accession NumberBC008406
Gene Symbol CD36
Gene ID (NCBI) 948
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
Excitation LaserYellow-Green Laser (561 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP16671
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Function

CD36, also known as platelet glycoprotein 4, is an integral membrane glycoprotein that acts as a scavenger receptor. CD36 can bind to multiple ligands, including thrombospondin-1, collagen, oxidized phospholipids, oxidized low-density lipoprotein, and long-chain fatty acids. CD36 can also bind to erythrocytes parasitized by Plasmodium falciparum and apoptotic cells. CD36 mediates different biological processes, acting as a signaling hub in angiogenesis, inflammatory response, and fatty acid metabolism.

Tissue specificity

CD36 is present on the surface of various cells types, such as adipocytes, monocytes, macrophages, platelets, microvascular endothelial cells, dendritic cells, and hematopoietic precursors of red cells.

Involvement in disease
  • Mutations in CD36 can give rise to platelet glycoprotein IV deficiency, a type of macrothrombocytopenia.

  • Polymorphisms in CD36 can increase susceptibility to malaria.

  • AAGIC haplotype at the CD36 locus increases the risk of coronary heart disease.

  • Disruption of CD36-dependent pathways and certain SNPs in the CD36 gene are attributed to impaired fatty acid metabolism, glucose intolerance, Alzheimer's disease, atherosclerosis, arterial hypertension, diabetes, and cardiomyopathy.

Isoforms

Apart from the full-length protein (isoform 1), one additional shorter isoform has been reported (PMID: 7509795). Other alternative isoforms have also been detected on the mRNA level (PMID: 17673938).

Post-translational modifications

The extracellular domain of CD36 is extensively glycosylated. Glycosylation is needed for the transport of CD36 to the plasma membrane, as well as mediating recognition and binding to ligands. Cytoplasmic tails of transmembrane domains can be phosphorylated and play a role in signal transduction. Intracellular domains can be additionally acetylated, ubiquitinated, and palmitoylated (PMID: 28919632).

Cellular localization

CD36 is present on the cell surface.            

Loading...
||
New chat

Able

正在加载,请稍候...