CD36 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  Sandwich ELISA standard curve of MP00992-4

  Sandwich ELISA standard curve of MP00992-4, Human CD36 Recombinant Matched Antibody Pair - PBS only. 84078-3-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg1070. 84078-5-PBS was HRP conjugated as the detection antibody. Range: 7.81-250 ng/mL.

• 

  Sample test of MP00992-4

  Serum of six individual healthy human donors was measured. The CD36 concentration of detected samples was determined to be 80.10 ng/mL with a range of 3.74-234.72 ng/mL.

• 

  Affinity and Kinetic Characterization of 84078-3-PBS

  Biolayer interferometry (BLl) kinetic assays of 84078-3-PBS against Human CD36 were performed. The affinity constant is 14.8 nM.

CD36 Uni-rAb^® Recombinant Antibody for Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 84078-3-PBS

Clone No.241262F8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

Glycoprotein IIIb, GP3B, GP4, GPIIIB, GPIV

---

Product Information

84078-3-PBS targets CD36 as part of a matched antibody pair:

MP00992-4: 84078-3-PBS capture and 84078-5-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1070

  Product name: Recombinant Human CD36/SR-B3 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 30-439 aa of NM_001001548.3

  Sequence: GDLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRFVLPSKAFASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETGTIGDEKANMFRSQVTGKIN

• Full Name: CD36 molecule (thrombospondin receptor)
• Calculated Molecular Weight: 53 kDa
• GenBank Accession Number: NM_001001548.3
• Gene Symbol: CD36
• Gene ID (NCBI): 948
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P16671-1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.