Anti-Mouse CD367/CLEC4A Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• Anti-Mouse CD367/CLEC4A Rabbit Recombinant Antibody (98688-2-RR)

CD367/CLEC4A Uni-rAb^® Recombinant Antibody for FC

Cat No. 98688-2-RR

Clone No.251355C11

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

CD367, Clec4a, Clec4a2, Clecsf6, C-type lectin domain family 4 member A

• 

  FC experiment of mouse bone marrow cells using 98688-2-RR

  1x10^6 mouse bone marrow cells were surface stained with 0.25 ug Anti-Mouse CD367/Clec4a Rabbit RecAb (98688-2-RR, Clone:251355C11) and PE-Conjugated Goat Anti-Rabbit IgG(H+L), or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9). Cells were not fixed.

• 

  FC experiment of mouse bone marrow cells using 98688-2-RR

  1x10^6 mouse bone marrow cells were surface stained with 0.25 ug Anti-Mouse CD367/Clec4a Rabbit RecAb (98688-2-RR, Clone:251355C11) and PE-Conjugated Goat Anti-Rabbit IgG(H+L) (red), or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue). Cells were not fixed.

---

Tested Applications

• Positive FC detected in: mouse bone marrow cells

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

98688-2-RR targets CD367/CLEC4A in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg5258

  Product name: recombinant mouse CD367/Clec4a protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 70-238 aa of NM_001170332.1

  Sequence: QKYSQLLEEKKAAKNIMHNELNCTKSVSPMEDKVWSCCPKDWRLFGSHCYLVPTVSSSASWNKSEENCSRMGAHLVVIQSQEEQDFITGILDTHAAYFIGLWDTGHRQWQWVDQTPYEESITFWHNGEPSSGNEKCATIIYRWKTGWGWNDISCSLKQKSVCQMKKINL

• Full Name: C-type lectin domain family 4, member a2
• Calculated Molecular Weight: 27 kDa
• GenBank Accession Number: NM_001170332.1
• Gene Symbol: Clec4a2
• Gene ID (NCBI): 26888
• RRID: AB_3746276
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9QZ15
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Background Information

CLEC4A (also commonly referred to as DCIR) belongs to the C-type lectin receptor (CLR) family and functions primarily as an inhibitory receptor in the immune system. It is a type II transmembrane protein containing a C-type lectin-like domain (CTLD). Uniquely among most CLRs, it possesses an immunoreceptor tyrosine-based inhibitory motif (ITIM) in its cytoplasmic tail (PMID: 35017526). Mice lacking Clec4a2 or Clec4a4 are highly susceptible to autoimmune conditions such as experimental arthritis and experimental autoimmune encephalomyelitis (EAE) due to excessive DC activation (PMID: 27068492).