CD3 Delta Recombinant monoclonal antibody, PBS Only

• 

CD3 Delta Uni-rAb^® Recombinant Antibody for Indirect ELISA

Cat No. 84214-1-PBS

Clone No.241523B6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Indirect ELISA

Synonyms

CD3D, CD3-delta, T cell receptor T3 delta chain, T3D, T-cell receptor T3 delta chain

---

Product Information

84214-1-PBS targets CD3 Delta in Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2288

  Product name: Recombinant Human CD3 delta protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 22-105 aa of BC070321

  Sequence: FKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVA

• Full Name: CD3d molecule, delta (CD3-TCR complex)
• Calculated Molecular Weight: 171 aa, 19 kDa
• GenBank Accession Number: BC070321
• Gene Symbol: CD3 Delta
• Gene ID (NCBI): 915
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P04234
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.