Use Able AI chat for product recommendations

CD4 Polyclonal antibody

CD4 Polyclonal Antibody for WB, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

WB, IP, ELISA

CD4 molecule, CD4mut, T-cell surface antigen T4/Leu-3, T-cell surface glycoprotein CD4

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for CD4 in ?

Tested Applications

Positive WB detected inU-937 cells, pig thymus tissue, mouse thymus tissue
Positive IP detected inmouse thymus tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

19068-1-AP targets CD4 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag13616

Product name: Recombinant human CD4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 419-458 aa of BC025782

Sequence: CVRCRHRRRQAERMSQIKRLLSEKKTCQCPHRFQKTCSPI

Predict reactive species
Full Name CD4 molecule
Calculated Molecular Weight 51 kDa
Observed Molecular Weight 55 kDa
GenBank Accession NumberBC025782
Gene Symbol CD4
Gene ID (NCBI) 920
ENSEMBL Gene IDENSG00000010610
RRIDAB_10603357
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP01730
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD4 is a 55-kDa transmembrane glycoprotein expressed on T helper cells, majority of thymocytes, monocytes, macrophages, and dendritic cells. CD4 is an accessory protein for MHC class-II antigen/T-cell receptor interaction. It plays an important role in T helper cell development and activation. CD4 serves as a receptor for the human immunodeficiency virus (HIV).

Protocols

Product Specific Protocols
IP protocol for CD4 antibody 19068-1-APDownload protocol
WB protocol for CD4 antibody 19068-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Anti-CD4 (Cat# 19068-1-AP) has accumulated 50 citations across diverse high-impact journals including Cell Metabolism, Journal of Hematology & Oncology, Cell Death & Disease, ACS Nano, Acta Pharmaceutica Sinica B, Frontiers in Immunology, mBio, iScience, Science Reports, and Bioactive Materials. Associated research fields span tumor immunology and cancer immunotherapy, T cell biology and immune regulation, neuroprotection, inflammatory diseases, nanomedicine and drug delivery, autoimmune disorders, and infectious disease.

SpeciesApplicationTitle
human

J Hematol Oncol

PD-1 axis expression in musculoskeletal tumors and antitumor effect of nivolumab in osteosarcoma model of humanized mouse.

Authors - Bingxin Zheng
human

Cell Metab

AARS1 promotes tumor progression and immune evasion via ATF6 lactylation-mediated tryptophan metabolism in hepatocellular carcinoma

Authors - Yiming Wang
mouse

Bioact Mater

Nano MgO loaded thermosensitive HPCH@HA hydrogel accelerates in situ bone repair through osteoimmunomodulation while enhancing angiogenesis and osteogenesis.

Authors - Feifei Ni

J Extracell Vesicles

Engineering high-affinity dual targeting cellular nanovesicles for optimised cancer immunotherapy

Authors - Luyao Zhang

ACS Nano

Biomineralized Albumin-Macrocyclic Conjugates for Synergistic Metal Ion-Based Combination Therapy in Cancer Treatment

Authors - Yu Zhang
mouse

Gut Microbes

Synergistic activity of Enterococcus Faecium-induced ferroptosis via expansion of IFN-γ+CD8+ T cell population in advanced hepatocellular carcinoma treated with sorafenib

Authors - Haitao Yu

Reviews

    3.0 out of 5
Add a review

2 verified customer reviews

What customers say

Two reviews were found for this product. One user (5 stars) used it for Western Blot and Immunoprecipitation on human samples with a brief positive note. Another user (1 star) reported no signal when performing Western Blot on HeLa cells expressing CD4 fusion constructs at a 1:1000 dilution, noting that expression was confirmed by other antibodies. Overall, results appear inconsistent, with one successful application and one failure to detect target protein.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Shriya (Verified Customer) (09-21-2025)

Cd4 polyclonal antibody.

  • Applications: Western Blot, Immunoprecipitation
  • Cell Tissue Type: Human

Nicole (Verified Customer) (04-28-2022)

no signal expression is controlled by other antibodies

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Hela, Plasmid driven expression of various CD4 fusion constructs
Loading...
||
New chat

Able™

正在加载,请稍候...