Tested Applications
| Positive WB detected in | U-937 cells, pig thymus tissue, mouse thymus tissue |
| Positive IP detected in | mouse thymus tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
19068-1-AP targets CD4 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13616 Product name: Recombinant human CD4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 419-458 aa of BC025782 Sequence: CVRCRHRRRQAERMSQIKRLLSEKKTCQCPHRFQKTCSPI Predict reactive species |
| Full Name | CD4 molecule |
| Calculated Molecular Weight | 51 kDa |
| Observed Molecular Weight | 55 kDa |
| GenBank Accession Number | BC025782 |
| Gene Symbol | CD4 |
| Gene ID (NCBI) | 920 |
| ENSEMBL Gene ID | ENSG00000010610 |
| RRID | AB_10603357 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P01730 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CD4 is a 55-kDa transmembrane glycoprotein expressed on T helper cells, majority of thymocytes, monocytes, macrophages, and dendritic cells. CD4 is an accessory protein for MHC class-II antigen/T-cell receptor interaction. It plays an important role in T helper cell development and activation. CD4 serves as a receptor for the human immunodeficiency virus (HIV).
Protocols
| Product Specific Protocols | |
|---|---|
| IP protocol for CD4 antibody 19068-1-AP | Download protocol |
| WB protocol for CD4 antibody 19068-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-CD4 (Cat# 19068-1-AP) has accumulated 50 citations across diverse high-impact journals including Cell Metabolism, Journal of Hematology & Oncology, Cell Death & Disease, ACS Nano, Acta Pharmaceutica Sinica B, Frontiers in Immunology, mBio, iScience, Science Reports, and Bioactive Materials. Associated research fields span tumor immunology and cancer immunotherapy, T cell biology and immune regulation, neuroprotection, inflammatory diseases, nanomedicine and drug delivery, autoimmune disorders, and infectious disease.
| Species | Application | Title |
|---|---|---|
J Hematol Oncol PD-1 axis expression in musculoskeletal tumors and antitumor effect of nivolumab in osteosarcoma model of humanized mouse. | ||
Cell Metab AARS1 promotes tumor progression and immune evasion via ATF6 lactylation-mediated tryptophan metabolism in hepatocellular carcinoma | ||
Bioact Mater Nano MgO loaded thermosensitive HPCH@HA hydrogel accelerates in situ bone repair through osteoimmunomodulation while enhancing angiogenesis and osteogenesis. | ||
J Extracell Vesicles Engineering high-affinity dual targeting cellular nanovesicles for optimised cancer immunotherapy | ||
ACS Nano Biomineralized Albumin-Macrocyclic Conjugates for Synergistic Metal Ion-Based Combination Therapy in Cancer Treatment | ||
Gut Microbes Synergistic activity of Enterococcus Faecium-induced ferroptosis via expansion of IFN-γ+CD8+ T cell population in advanced hepatocellular carcinoma treated with sorafenib |
Reviews
What customers say
Two reviews were found for this product. One user (5 stars) used it for Western Blot and Immunoprecipitation on human samples with a brief positive note. Another user (1 star) reported no signal when performing Western Blot on HeLa cells expressing CD4 fusion constructs at a 1:1000 dilution, noting that expression was confirmed by other antibodies. Overall, results appear inconsistent, with one successful application and one failure to detect target protein.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Shriya (Verified Customer) (09-21-2025) | Cd4 polyclonal antibody.
|
Nicole (Verified Customer) (04-28-2022) | no signal expression is controlled by other antibodies
|
