CD40 Recombinant monoclonal antibody, PBS Only

CD40 Uni-rAb® Recombinant Antibody for WB, IF/ICC, Indirect ELISA
Cat No. 84406-2-PBS
Clone No.241760A11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

241760A11, B cell surface antigen CD40, B-cell surface antigen CD40, Bp50, CD40L receptor

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84406-2-PBS targets CD40 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg1797

Product name: Recombinant Human CD40/TNFRSF5 protein (rFc Tag)(HPLC verified)

Source: mammalian cells-derived, pHZ-KIsec-C-rFc

Tag: C-rFc

Domain: 21-193 aa of NM_001250.6

Sequence: EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR

Predict reactive species
Full Name CD40 molecule, TNF receptor superfamily member 5
Calculated Molecular Weight31kDa
Observed Molecular Weight45 kDa
GenBank Accession NumberNM_001250.6
Gene Symbol CD40
Gene ID (NCBI) 958
ENSEMBL Gene IDENSG00000101017
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP25942-1
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Cluster of differentiation 40 (CD40) is a costimulatory protein located on antigen presenting cells and is required for their activation. CD40 is a member of the tumor necrosis factor (TNF) receptor (TNFR) family.

What is the molecular weight of CD40?

The molecular weight of CD40 is 43 kDa.

What is the cellular localization of CD40?

CD40 can be secreted by cells or found in the cell membrane.

What is the tissue specificity of CD40?

CD40 is expressed in B cells and primary carcinoma cells but is also found in dendritic cells and macrophages (PMID: 10209159).

What is the function of CD40?

CD40 acts as a receptor for TNFSF5/CD40LG, which is expressed on activated T cells. This interaction is essential for B cell proliferation, expression of activation markers, immunoglobulin production, and isotype switching (PMID: 8809473). This interaction is also crucial for the formation of memory B cells and germinal centers, and signaling through CD40 prevents apoptosis of germinal center B cells.

What is the role of CD40 in disease?

Defects in CD40 lead to hyper-IgM immunodeficiency syndrome type 3 (HIGM3) (PMID: 11675497). This is an autosomal recessive disorder that includes the inability of B cells to undergo isotype switching, a key step in the final differentiation of the humoral immune response, and an inability to mount an antibody-specific immune response.



Loading...
||
New chat Able
正在加载,请稍候...