CD41/Integrin alpha 2b Fusion Protein

Catalog number: Ag19459
  • Print page
  • Download PDF

Be the first to review this product


$199.00€199.00£199.00

Freight/Packing £00.00

Size: 09µ/gram

Format: Liquid

Please visit your regions distributor:


You can also
Request A Quote

Images See all

CD41/Integrin alpha 2b fusion protein Ag19459 SDS-PAGE


Product Name:
human ITGA2B-GST fusion protein

Catalog No:
Ag19459

Source:
E. coli-derived, PGEX-4T

Peptide Sequence:
AELAVHLPQGAHYMRALSNVEGFERLICNQKKENETRVVLCELGNPMKKNAQIGIAMLVSVGNLEEAGESVSFQLQIRSKNSQNPNSKIVLLDVPVRAEAQVELRGNSFPASLVVAAEEGEREQNSLDSWGPKVEHTYELHNNGPGTVNGLHLSIHLPGQSQPSDLLYILDIQPQGGLQCFPQPPVNPLKVDWGLPIPSPSPIHPAHHKRDRRQIFL
(678-894 aa encoded by BC126442)

Activity:
Not tested.

Endotoxin Level:
Please contact the lab for more information.

Back
to top