Anti-Mouse CD44 Rabbit Recombinant Antibody

CD44 Uni-rAb® Recombinant Antibody for FC
Cat No. 98359-2-RR
Clone No.242666F8

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

242666F8, CD44 antigen, CDw44, CSPG8, ECMR III

Formulation:  PBS, Azide
PBS, Azide
PBS Only
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inmouse splenocytes

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 0.125 ug per 10^6 cells in a 100 µl suspension
This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

98359-2-RR targets CD44 in FC applications and shows reactivity with mouse samples.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg3159

Product name: Recombinant Mouse CD44 protein (rFc Tag) (HPLC verified)

Source: mammalian cells-derived, V37

Tag: C-rFc

Domain: 25-224 aa of NM_009851.2

Sequence: QIDLNVTCRYAGVFHVEKNGRYSISRTEAADLCQAFNSTLPTMDQMKLALSKGFETCRYGFIEGNVVIPRIHPNAICAANHTGVYILVTSNTSHYDTYCFNASAPPEEDCTSVTDLPNSFDGPVTITIVNRDGTRYSKKGEYRTHQEDIDASNIIDDDVSSGSTIEKSTPESYILHTYLPTEQPTGDQDDSFFIRSTLAT

Predict reactive species
Full Name CD44 antigen
Calculated Molecular Weight86 kDa
GenBank Accession NumberNM_009851.2
Gene Symbol Cd44
Gene ID (NCBI) 12505
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDNP_033981
Storage Buffer PBS with 0.09% sodium azide, pH 7.3.
Storage ConditionsStore at 2 - 8°C. Stable for one year after shipment.

Background Information

CD44 is a type I transmembrane glycoprotein expressed on embryonic stem cells and in various levels on other cell types including connective tissues and bone marrow. CD44 expression is also upregulated in subpopulations of cancer cells and is recognized as a molecular marker for cancer stem cells (PMID: 29747682). It is a cell-surface receptor that mediates cell-cell and cell-matrix interactions through its affinity for hyaluronic acid (HA) and possibly also through its affinity for other ligands (PMID: 10694938). Adhesion with HA plays an important role in cell migration, tumor growth and progression. CD44 is also involved in lymphocyte activation, recirculation and homing, and in hematopoiesis.

Protocols

Product Specific Protocols
FC protocol for CD44 antibody 98359-2-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...