CD47 Recombinant monoclonal antibody, PBS Only

• 

  Affinity and Kinetic Characterization of 80924-4-PBS

  Biolayer interferometry (BLl) kinetic assay of 80924-4-PBS against Human CD47 was performed. The affinity constant is 35.8 nM.

CD47 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Indirect ELISA

Cat No. 80924-4-PBS

Clone No.240997H6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Synonyms

CD47 molecule, IAP, Integrin associated protein, Integrin-associated protein, Leukocyte surface antigen CD47

---

Product Information

80924-4-PBS targets CD47 in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg31499

  Product name: Recombinant Human CD47 protein (Myc Tag, His Tag)

  Source: mammalian cells-derived, pHZ-KIsec

  Tag: Myc & 6*His

  Domain: 19-139 aa of BC010016

  Sequence: QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVCVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP

• Full Name: CD47 molecule
• Calculated Molecular Weight: 323 aa, 35 kDa
• GenBank Accession Number: BC010016
• Gene Symbol: CD47
• Gene ID (NCBI): 961
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q08722
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.