CD47 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 80928-2-RR (same clone as 80928-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 80928-2-RR (CD47 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 80928-2-PBS in a different storage buffer formulation.

• 

  Affinity of 80928-2-RR

  Biolayer interferometry (BLl) kinetic assays of 80928-2-RR against Human CD47 were performed. The affinity constant is below 1 pM.

CD47 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 80928-2-PBS

Clone No.251993B3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

CD47 molecule, IAP, Integrin associated protein, Integrin-associated protein, Leukocyte surface antigen CD47

---

Product Information

80928-2-PBS targets CD47 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1767

  Product name: Recombinant Human CD47 protein (rFc Tag)(HPLC verified)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 19-139 aa of NM_001777.4

  Sequence: QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP

• Full Name: CD47 molecule
• Calculated Molecular Weight: 35kDa
• Observed Molecular Weight: 50-55 kDa
• GenBank Accession Number: NM_001777.4
• Gene Symbol: CD47
• Gene ID (NCBI): 961
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q08722-1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CD47, also known as integrin-associated protein (IAP), is a member of the immunoglobulin superfamily containing a five-pass transmembrane attachment. CD47 is heavily glycosylated and widely expressed by hematopoietic and nonhematopoietic cells. CD47 interacts with several membrane integrins and also acts as a receptor for thrombospondin (THBS1). It is involved in a range of cellular processes, including apoptosis, proliferation, adhesion, and migration. CD47 also functions as a ligand for signal regulatory protein-α (SIRPα). Upon binding CD47, SIRPα initiates a signaling cascade that results in the inhibition of phagocytosis.