Mouse CD47 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of mouse spleen using 85958-1-RR (same clone as 85958-1-PBS)

  Mouse spleen tissue was subjected to SDS PAGE followed by western blot with 85958-1-RR (CD47 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85958-1-PBS in a different storage buffer formulation.

• 

  IF Staining of RAW 264.7 using 85958-1-RR (same clone as 85958-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed RAW 264.7 cells using CD47 antibody (85958-1-RR, Clone: 242850C4 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 85958-1-PBS in a different storage buffer formulation.

CD47 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 85958-1-PBS

Clone No.242850C4

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

IAP, Integrin-associated protein, Leukocyte surface antigen CD47

---

Product Information

85958-1-PBS targets CD47 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1394

  Product name: Recombinant Mouse CD47 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 19-140 aa of NP_001355344.1

  Sequence: QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTVSWFSPNEK

• Full Name: CD47 antigen (Rh-related antigen, integrin-associated signal transducer)
• Calculated Molecular Weight: 33 kDa
• Observed Molecular Weight: 45-55 kDa
• GenBank Accession Number: NP_001355344.1
• Gene Symbol: Cd47
• Gene ID (NCBI): 16423
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q61735-1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CD47, also known as integrin-associated protein (IAP), is a member of the immunoglobulin superfamily containing a five-pass transmembrane attachment. CD47 is heavily glycosylated and widely expressed by hematopoietic and nonhematopoietic cells. CD47 interacts with several membrane integrins and also acts as a receptor for thrombospondin (THBS1). It is involved in a range of cellular processes, including apoptosis, proliferation, adhesion, and migration. CD47 also functions as a ligand for signal regulatory protein-α (SIRPα). Upon binding CD47, SIRPα initiates a signaling cascade that results in the inhibition of phagocytosis.