CD52 Monoclonal antibody, PBS Only

• 

  WB analysis of human spleen using 66784-1-Ig (same clone as 66784-1-PBS)

  human spleen tissue were subjected to SDS PAGE followed by western blot with 66784-1-Ig (CD52 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66784-1-PBS in a different storage buffer formulation.

CD52 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 66784-1-PBS

Clone No.1B10E8

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

1B10E8, Cambridge pathology 1 antigen, CAMPATH 1 antigen, CAMPATH-1 antigen, CD52 molecule

---

Product Information

66784-1-PBS targets CD52 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17788

  Product name: Recombinant human CD52 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 20-61 aa of BC000644

  Sequence: QTGLSGQNDTSQTSSPSASSSMSGGIFLFFVANAIIHLFCFS

• Full Name: CD52 molecule
• Calculated Molecular Weight: 6 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC000644
• Gene Symbol: CD52
• Gene ID (NCBI): 1043
• RRID: AB_2882129
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P31358
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.