Anti-Mouse CD53 Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• Anti-Mouse CD53 Rabbit Recombinant Antibody (98436-3-RR)

• 

  FC experiment of mouse splenocytes using 98436-3-RR

  1x10^6 mouse splenocytes were surface stained with 0.125 ug Anti-Mouse Cd53 Rabbit RecAb (98436-3-RR, Clone:250105D10) or Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were then stained with CoraLite® Plus 488 Anti-Mouse CD4. Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed.

• 

  FC experiment of mouse splenocytes using 98436-3-RR

  1x10^6 mouse splenocytes were surface stained with 0.125 ug Anti-Mouse Cd53 Rabbit RecAb (98436-3-RR, Clone: 250105D10) (red) or Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9)(blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed.

CD53 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98436-3-RR

Clone No.250105D10

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

Cell surface glycoprotein CD53, Leukocyte surface antigen CD53

---

Tested Applications

• Positive FC detected in: mouse splenocytes

Recommended dilution

• Flow Cytometry (FC): FC : 0.13 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

98436-3-RR targets CD53 in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2684

  Product name: Recombinant Mouse CD53 protein (rFc Tag)(HPLC verified)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 107-181 aa of NM_007651.3

  Sequence: EQKLNTLVAEGLNDSIQHYHSDNSTMKAWDFIQTQLQCCGVNGSSDWTSGPPSSCPSGADVQGCYNKAKSWFHSN

• Full Name: CD53 antigen
• Calculated Molecular Weight: 24 kDa
• GenBank Accession Number: NM_007651.3
• Gene Symbol: Cd53
• Gene ID (NCBI): 12508
• RRID: AB_3746074
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q61451
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Background Information

CD53 is also named as MOX44 and Tetraspanin-25 (Tspan-25). Tetraspanin CD53 is a member of the tetraspanin superfamily expressed exclusively within the immune compartment (PMID: 32440787). T cells depend on the phosphatase CD45 to initiate T cell receptor signaling. CD53 is shown to stabilize CD45 on the membrane and is required for optimal phosphatase activity and subsequent Lck activation. Together, CD53 as a regulator of CD45 activity required for T cell immunity (PMID: 35767951). CD53 is a marker for positively selected CD4+ CD8+ thymocytes (PMID: 11867561).