Tested Applications
| Positive WB detected in | HeLa cells, A549 cells, MKN-45 cells, human placenta tissue, K-562 cells |
| Positive IHC detected in | human lung cancer tissue, human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A549 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
82781-6-RR targets CD55 in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag25026 Product name: Recombinant human CD55 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 35-126 aa of BC001288 Sequence: DCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVE Predict reactive species |
| Full Name | CD55 molecule, decay accelerating factor for complement (Cromer blood group) |
| Calculated Molecular Weight | 41 kDa |
| Observed Molecular Weight | 75 kDa |
| GenBank Accession Number | BC001288 |
| Gene Symbol | CD55 |
| Gene ID (NCBI) | 1604 |
| RRID | AB_3086534 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P08174 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CD55, also known as DAF, is a glycosylphosphatidylinositol (GPI)-anchored surface glycoprotein that is widely distributed on blood, stroma, epithelial, and endothelial cells (PMID: 7517044; 29503741). It can also exist as a soluble form in plasma, urine, saliva, tears, and synovial fluids (PMID: 29503741). CD55 is a complement regulatory protein (PMID: 2469439; 7517044). It inhibits formation of the C3 convertases through binding to C3b and C4b. It also binds the alternate pathway convertase C3bBb, the classical pathway convertase and C4b2a to accelerate their decay (PMID: 17289551). CD55 also serves as a receptor for coxsackieviruses B1, B3, and B5 and several enteroviruses (PMID: 7538177; 7517044). The observed molecular weight of mature CD55 varies between 50 to 100 kDa depending on the cell type. Different sizes of CD55 might be caused by alternative splicing or different glycosylation patterns (PMID: 29503741).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CD55 antibody 82781-6-RR | Download protocol |
| IHC protocol for CD55 antibody 82781-6-RR | Download protocol |
| WB protocol for CD55 antibody 82781-6-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CD55 Recombinant monoclonal antibody (2D2), catalog number 82781-6-RR, has 1 citation. It was used in a study published in Cell Death & Disease (IF 12.2) investigating the GDPD5-CD55-EGFR competitive binding axis in rectal cancer. The research field encompasses tumor biology, specifically radioresistance mechanisms and lipid accumulation in colorectal malignancy. The antibody was applied via WB, IF, and CoIP in human samples.
| Species | Application | Title |
|---|---|---|
Cell Death Dis GDPD5-CD55-EGFR competitive binding axis regulates radioresistance and lipid accumulation in rectal cancer.
|
Reviews
What customers say
One reviewer gave this CD55 recombinant rabbit antibody a 5-star rating for immunofluorescence on FFPE human tonsil tissue. Staining was well localized in germinal centers as expected. The protocol used 1:100 dilution with overnight incubation at 4°C after Dako antigen retrieval (pH 9), followed by goat anti-rabbit secondary at 1:1000 for 1 hour at room temperature. Overall, the user reported the antibody worked perfectly out of the box.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Maxence (Verified Customer) (01-26-2026) | This CD55 works perfectly in IF-P. The staining is well localized in the germinal centers of the tonsil, as expected. The IF was performed on FFPE human tonsil tissue slide with Dako antigen retrival pH9. Primary incubation was performed at 1:100 overnight (16h) at 4°C. Secondary incubation was performed with Goat anti-Rabbit at 1:1000 for 1h at RT. Image were taken with a Leica THUNDER at 10x and 20x magnification.
 |
