Anti-Human CD55 Rabbit Recombinant Antibody, PBS Only

• 

  FC experiment of human blood using 98493-3-RR (same clone as 98493-3-PBS)

  1x10^6 human blood cells were surface stained with 0.25 ug Anti-Human CD55 Rabbit RecAb (98493-3-RR, Clone: 250682C11) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9), and PE-conjugated Goat Anti-Rabbit IgG. Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed. This data was developed using the same antibody clone with 98493-3-PBS in a different storage buffer formulation.

• 

  FC experiment of human blood using 98493-3-RR (same clone as 98493-3-PBS)

  1x10^6 human blood cells were surface stained with 0.25 ug Anti-Human CD55 Rabbit RecAb (98493-3-RR, Clone:250682C11) (red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and PE-conjugated Goat Anti-Rabbit IgG. Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed. This data was developed using the same antibody clone with 98493-3-PBS in a different storage buffer formulation.

CD55 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98493-3-PBS

Clone No.250682C11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

Synonyms

Complement decay-accelerating factor, CR, CROM, DAF, TC

---

Product Information

98493-3-PBS targets CD55 in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg4246

  Product name: Recombinant Human CD55 protein (rFc Tag)(HPLC verified)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 35-353 aa of BC001288

  Sequence: DCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLSPKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGILFGATISFSCNTGYKLFGSTSSFCLISGSSVQWSDPLPECREIYCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRGKSLTSKVPPTVQKPTTVNVPTTEVSPTSQKTTTKTTTPNAQATRSTPVSRTTKHFHETTPNKGSGTTS

• Full Name: CD55 molecule, decay accelerating factor for complement (Cromer blood group)
• Calculated Molecular Weight: 41 kDa
• GenBank Accession Number: BC001288
• Gene Symbol: CD55
• Gene ID (NCBI): 1604
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P08174
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CD55, also known as DAF, is a glycosylphosphatidylinositol (GPI)-anchored surface glycoprotein that is widely distributed on blood, stroma, epithelial, and endothelial cells (PMID: 7517044; 29503741). It can also exist as a soluble form in plasma, urine, saliva, tears, and synovial fluids (PMID: 29503741). CD55 is a complement regulatory protein (PMID: 2469439; 7517044). It inhibits formation of the C3 convertases through binding to C3b and C4b. It also binds the alternate pathway convertase C3bBb, the classical pathway convertase and C4b2a to accelerate their decay (PMID: 17289551). CD55 also serves as a receptor for coxsackieviruses B1, B3, and B5 and several enteroviruses (PMID: 7538177; 7517044).