CD6 Polyclonal antibody

• 

  IHC staining of human tonsillitis using 16763-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 16763-1-AP (CD6 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 16763-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 16763-1-AP (CD6 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

CD6 Polyclonal Antibody for IHC, ELISA

Cat No. 16763-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

Synonyms

CD6 molecule, Soluble CD6, T12, T-cell differentiation antigen CD6, TP120

---

Tested Applications

• Positive IHC detected in: human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16763-1-AP targets CD6 in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10336

  Product name: Recombinant human CD6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 16-350 aa of BC078669

  Sequence: SGHPSPAPPDQLNTSSAESELWEPGERLPVRLTNGSSSCSGTVEVRLEASWEPACGALWDSRAAEAVCRALGCGGAEAASQLAPPTPELPPPPAAGNTSVAANATLAGAPALLCSGAEWRLCEVVEHACRSDGRRARVTCAENRALRLVDGGGACAGRVEMLEHGEWGSVCDDTWDLEDAHVVCRQLGCGWAVQALPGLHFMPGRGPIHRDQVNCSGAEAYLWDCPGLPGQHYCGHKEDAGVVCSEHQSWRLTGGADRCEGQVEVHFRGVWNTVCDSEWYPSEAKVLCQSLGCGTAVERPKGLPHSLSGRMYYSCNGEELTLSNCSWRFNNSNLC

• Full Name: CD6 molecule
• Calculated Molecular Weight: 668 aa, 72 kDa
• GenBank Accession Number: BC078669
• Gene Symbol: CD6
• Gene ID (NCBI): 923
• RRID: AB_2878312
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P30203
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD6 is a type I transmembrane glycoprotein of 105-130 kDa that belongs to the scavenger receptor cysteine-rich superfamily (PMID: 21880988). It is composed of an extracellular region, which consists of three tandem SRCR domains, a transmembrane region, and a cytoplasmic tail devoid of intrinsic catalytic activity but harboring several phosphorylatable residues suitable for intracellular signal transduction (PMID: 38139340; 23711376). CD6 is expressed by T cells, medullary thymocytes, a subset of B cells and NK cells, and in some cells of the brain (PMID: 1919444; 21178331). CD6 plays a role in lymphocyte activation, proliferation, and survival processes via interaction with its endogenous ligands.