Mouse CD62L Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85903-1-RR (same clone as 85903-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85903-1-RR (CD62L antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85903-1-PBS in a different storage buffer formulation.

CD62L Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 85903-1-PBS

Clone No.250271C5

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, Indirect ELISA

Synonyms

L-selectin, CD62 antigen-like family member L, L selectin, LAM-1, LECAM 1

---

Product Information

85903-1-PBS targets CD62L in WB, Indirect ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3845

  Product name: Recombinant Mouse CD62L protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 39-332 aa of NM_011346.2

  Sequence: WTYHYSEKPMNWENARKFCKQNYTDLVAIQNKREIEYLENTLPKSPYYYWIGIRKIGKMWTWVGTNKTLTKEAENWGAGEPNNKKSKEDCVEIYIKRERDSGKWNDDACHKRKAALCYTASCQPGSCNGRGECVETINNHTCICDAGYYGPQCQYVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAETQCGASGNWSSPEPICQVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAETQCGASGNWSSPEPICQETNRSFSKIKEGDYN

• Full Name: selectin, lymphocyte
• Calculated Molecular Weight: 42 kDa
• Observed Molecular Weight: 70-85 kDa
• GenBank Accession Number: NM_011346.2
• Gene Symbol: CD62L
• Gene ID (NCBI): 20343
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P18337
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CD62L, also known as L-selectin or SELL, is a member of the selectin family of adhesion molecules that also include CD62E (E-selectin) and CD62P (P-selectin) (PMID: 2663882, 2473156, 1382078). CD62L is a highly glycosylated protein expressed on the surface of most leukocytes, including lymphocytes, neutrophils, monocytes, eosinophils, hematopoietic progenitor cells, and immature thymocytes (PMID: 1694883, 1688580). It mediates the binding of lymphocytes to high endothelial venules (HEV) of peripheral lymph nodes through interactions with a constitutively expressed ligand, and is also involved in lymphocyte, neutrophil, and monocyte attachment to endothelium at sites of inflammation (PMID: 1382078).