CD63 Recombinant monoclonal antibody, PBS Only (Detector)

• 

  Sandwich ELISA standard curve of MP01370-1

  Sandwich ELISA standard curve of MP01370-1, Human CD63 Recombinant Matched Antibody Pair - PBS only. 84507-3-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg2064. 84507-1-PBS was HRP conjugated as the detection antibody. Range: 93.8-6000 pg/mL.

• 

  Sample test of MP01370-1

  Serum of eight individual healthy human donors was measured. The CD63 concentration of detected samples was determined to be 259.0 pg/mL with a range of 46.2-1,067.1 pg/mL.

• 

  Cytometric bead array standard curve of MP01370-1

  Cytometric bead array standard curve of MP01370-1, CD63 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 84507-3-PBS. Detection antibody: 84507-1-PBS. Standard: Eg2064. Range: 0.156-20 ng/mL.

CD63 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 84507-1-PBS

Clone No.241964A2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

CD 63, CD63 antigen, Limp1, Lysosomal-associated membrane protein 3, Lysosome integral membrane protein 1

---

Product Information

84507-1-PBS targets CD63 as part of a matched antibody pair:

MP01370-1: 84507-3-PBS capture and 84507-1-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2064

  Product name: Recombinant Human CD63 protein (rFc Tag)(HPLC verified)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 103-203 aa of BC002349

  Sequence: AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNV

• Full Name: CD63 molecule
• Calculated Molecular Weight: 26 kDa
• GenBank Accession Number: BC002349
• Gene Symbol: CD63
• Gene ID (NCBI): 967
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P08962
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.