CD68 Monoclonal antibody, PBS Only (Capture)

CD68 Monoclonal Antibody for Cytometric bead array, Indirect ELISA
Cat No. 66231-1-PBS
Clone No.3F10E11

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

Cytometric bead array, Indirect ELISA

3F10E11, CD68 molecule, GP110, Macrosialin, SCARD1

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66231-1-PBS targets CD68 as part of a matched antibody pair:

MP50230-1: 66231-1-PBS capture and 66231-3-PBS detection (validated in Cytometric bead array)

MP50230-2: 66231-1-PBS capture and 66231-4-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag22815

Product name: Recombinant human CD68 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 29-319 aa of BC015557

Sequence: SATLLPSFTVTPTVTESTGTTSHRTTKSHKTTTHRTTTTGTTSHGPTTATHNPTTTSHGNVTVHPTSNSTATSQGPSTATHSPATTSHGNATVHPTSNSTATSPGFTSSAHPEPPPPSPSPSPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSFPYGHLSFGFMQDLQQKVVYLSYMAVEYNVSFPHAAQWTFSAQNASLRDLQAPLGQSFSCSNSSIILSPAVHLDLLSLRLQAAQLPHTGVFGQSFSCPSDRS

Predict reactive species
Full Name CD68 molecule
Calculated Molecular Weight 37 kDa
GenBank Accession NumberBC015557
Gene Symbol CD68
Gene ID (NCBI) 968
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP34810
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CD68 is a type I transmembrane glycoprotein that is highly expressed by human monocytes and tissue macrophages. It belongs to the lysosomal/endosomal-associated membrane glycoprotein (LAMP) family and primarily localizes to lysosomes and endosomes with a smaller fraction circulating to the cell surface. CD68 is also a member of the scavenger receptor family. It may play a role in phagocytic activities of tissue macrophages.

Loading...
||
New chat

Able

正在加载,请稍候...