Anti-Human CD69 Rabbit Recombinant Antibody

• 

  FC experiment of human PBMCs using 98173-2-RR

  1x10^6 untreated or PHA-treated human PBMCs were surface stained with 0.25 ug Anti-Human CD69 Rabbit Recombinant Antibody (98173-2-RR, Clone: 241552F1) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were then stained with APC Anti-Human CD4 (RPA-T4). Cells were not fixed.

• 

  FC experiment of human PBMCs using 98173-2-RR

  1x10^6 PHA-treated human PBMCs were surface stained with 0.25 ug Anti-Human CD69 Rabbit Recombinant Antibody (98173-2-RR, Clone: 241552F1) (red) or 0.25 ug Isotype Control (blue) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). 1x10^6 untreated human PBMCs were surface stained with 0.25 ug Anti-Human CD69 Rabbit Recombinant Antibody (98173-2-RR, Clone:241552F1)(black, dashed) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed.

• 

  FC experiment of Cnyo PBMCs using 98173-2-RR

  1x10^6 Cnyo PBMCs were surface stained with 0.25 ug Anti-Human CD69 Rabbit RecAb (98173-2-RR, Clone:241552G10) or Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9), and PE-conjugated Goat Anti-Rabbit IgG. Cells were not fixed.

• 

  FC experiment of Cnyo PBMCs using 98173-2-RR

  1x10^6 cynomolgus PBMCs were surface stained with 0.25 ug Anti-Human CD69 Rabbit RecAb (98173-2-RR, Clone: 241552G10) (red) or Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9) (blue), and PE-conjugated Goat Anti-Rabbit IgG. Cells were not fixed.

CD69 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98173-2-RR

Clone No.241552G10

Host / Isotype

Rabbit / IgG

Reactivity

human, monkey, non-human primates

Applications

FC

Synonyms

Activation inducer molecule, AIM, BL AC/P26, BL-AC/P26, CD69 molecule

---

Tested Applications

• Positive FC detected in: PHA treated human PBMCs, cynomolgus PBMCs

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

98173-2-RR targets CD69 in FC applications and shows reactivity with human, monkey, non-human primates samples.

• Tested Reactivity: human, monkey, non-human primates
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1791

  Product name: Recombinant Human CD69 protein (rFc Tag) (HPLC verified)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 62-199 aa of NM_001781.2

  Sequence: SVGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK

• Full Name: CD69 molecule
• Calculated Molecular Weight: 23 kDa
• GenBank Accession Number: NM_001781.2
• Gene Symbol: CD69
• Gene ID (NCBI): 969
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q07108
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Background Information

CD69, also known as AIM, EA-1, Leu-23, and MLR3, is a type II transmembrane glycoprotein that belongs to the C-type lectin superfamily (PMID: 8340758; 7804122). CD69 is constitutively expressed by mature thymocytes, platelets, several subsets of tissue resident immune cells (including resident memory T cells and gamma delta T cells), and is inducibly expressed by activated T cells, B cells, natural killer (NK) cells, monocytes, neutrophils (PMID: 8100776; 28475283). CD69 has been identified as an early activation marker of lymphocytes and is commonly used as a marker of activated lymphocytes and NK cells (PMID: 28475283; 25759842). It is involved in the regulation of immune responses (PMID: 15745855).