Anti-Mouse CD69 Rabbit Recombinant Antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• Anti-Mouse CD69 Rabbit Recombinant Antibody, PBS Only (98440-2-PBS)

• 

  FC experiment of mouse splenocytes using 98440-2-RR (same clone as 98440-2-PBS)

  1x10^6 untreated or anti-CD3/CD28 treated mouse splenocytes were surface stained with 0.25 ug Anti-Mouse CD69 Rabbit RecAb (98440-2-RR, Clone:250269C11) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were then stained with CoraLite® Plus 647 Anti-Mouse CD3. Cells were not fixed. This data was developed using the same antibody clone with 98440-2-PBS in a different storage buffer formulation.

• 

  FC experiment of mouse splenocytes using 98440-2-RR (same clone as 98440-2-PBS)

  1x10^6 anti-CD3/CD28 treated mouse splenocytes were surface stained with 0.25 ug Anti-Mouse CD69 Rabbit RecAb (98440-2-RR, Clone: 250269C11) (red) or Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). 1x10^6 untreated mouse splenocytes were surface stained with 0.25 ug Anti-Mouse CD69 Rabbit Recombinant Antibody (98440-2-RR, Clone: 250269C11) and PE-Conjugated Goat Anti-Rabbit IgG(H+L) (black, dashed). Cells were not fixed. This data was developed using the same antibody clone with 98440-2-PBS in a different storage buffer formulation.

CD69 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98440-2-PBS

Clone No.250269C11

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

AIM, CD69 antigen, VEA

---

Product Information

98440-2-PBS targets CD69 in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3835

  Product name: Recombinant Mouse CD69 protein (rFc Tag) (HPLC verified)

  Source: mammalian cells-derived, pHZ-KIsec-N-rFc

  Tag: N-rFc

  Domain: 62-199 aa of NM_001033122.3

  Sequence: NVGKYNCPGLYEKLESSDHHVATCKNEWISYKRTCYFFSTTTKSWALAQRSCSEDAATLAVIDSEKDMTFLKRYSGELEHWIGLKNEANQTWKWANGKEFNSWFNLTGSGRCVSVNHKNVTAVDCEANFHWVCSKPSR

• Full Name: CD69 antigen
• Calculated Molecular Weight: 23 kDa
• GenBank Accession Number: NM_001033122.3
• Gene Symbol: Cd69
• Gene ID (NCBI): 12515
• RRID: AB_3746078
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P37217
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CD69, also known as AIM, EA-1, Leu-23, and MLR3, is a type II transmembrane glycoprotein that belongs to the C-type lectin superfamily (PMID: 8340758; 7804122). CD69 is constitutively expressed by mature thymocytes, platelets, several subsets of tissue resident immune cells (including resident memory T cells and gamma delta T cells), and is inducibly expressed by activated T cells, B cells, natural killer (NK) cells, monocytes, neutrophils (PMID: 8100776; 28475283). CD69 has been identified as an early activation marker of lymphocytes and is commonly used as a marker of activated lymphocytes and NK cells (PMID: 28475283; 25759842). It is involved in the regulation of immune responses (PMID: 15745855).