CD7 Polyclonal antibody

CD7 Polyclonal Antibody for IHC, IF-P, ELISA
Cat No. 11320-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF-P, ELISA

CD7 molecule, GP40, LEU-9, T cell antigen CD7, T cell leukemia antigen

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inhuman tonsillitis tissue, human lung cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman tonsillitis tissue

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11320-1-AP targets CD7 in IHC, IF-P, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0486

Product name: Recombinant human CD7 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-240 aa of BC009293

Sequence: MAGPPRLLLLPLLLALARGLPGALAAQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALPAALAVISFLLGLGLGVACVLARTQIKKLCSWRDKNSAACVVYEDMSHSRCNTLSSPNQYQ

Predict reactive species
Full Name CD7 molecule
Calculated Molecular Weight 240 aa, 25 kDa
GenBank Accession NumberBC009293
Gene Symbol CD7
Gene ID (NCBI) 924
ENSEMBL Gene IDENSG00000173762
RRIDAB_2877758
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP09564
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD7, also known as Leu-9 or GP40, is a 40-kDa single-pass type I transmembrane glycoprotein belonging to the immunoglobulin superfamily. CD7 is expressed on thymocytes, T cells, NK cells, and cells in the early stages of T, B, and myeloid cell differentiation (PMID: 10530432). It is one of the earliest antigens to appear on cells of the T-lymphocyte lineage (PMID: 3501369). CD7 plays a significant role in T-cell and T-cell/B-cell interactions during early lymphoid development. It is involved in the regulation of cell signaling and biology, including T-cell activation, proliferation, and the expression of interleukin-2 receptor alpha (IL-2Rα) (PMID: 11485208). CD7 is not only a marker for T-cells but also has functional implications in immune cell interactions and adhesion. It can provide co-stimulatory signals and is associated with CD3 and CD45, participating in T-cell activation (PMID: 7523512).

Protocols

Product Specific Protocols
IF protocol for CD7 antibody 11320-1-APDownload protocol
IHC protocol for CD7 antibody 11320-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...