CD7 Polyclonal antibody

• 

  IHC staining of human tonsillitis using 11320-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 11320-1-AP (CD7 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 11320-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 11320-1-AP (CD7 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 11320-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 11320-1-AP (CD7 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 11320-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 11320-1-AP (CD7 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of human tonsillitis using 11320-1-AP

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using CD7 antibody (11320-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of human tonsillitis using 11320-1-AP

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using CD7 antibody (11320-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

CD7 Polyclonal Antibody for IHC, IF-P, ELISA

Cat No. 11320-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF-P, ELISA

Synonyms

CD7 molecule, GP40, LEU-9, T cell antigen CD7, T cell leukemia antigen

---

Tested Applications

• Positive IHC detected in: human tonsillitis tissue, human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human tonsillitis tissue

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11320-1-AP targets CD7 in IHC, IF-P, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0486

  Product name: Recombinant human CD7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-240 aa of BC009293

  Sequence: MAGPPRLLLLPLLLALARGLPGALAAQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALPAALAVISFLLGLGLGVACVLARTQIKKLCSWRDKNSAACVVYEDMSHSRCNTLSSPNQYQ

• Full Name: CD7 molecule
• Calculated Molecular Weight: 240 aa, 25 kDa
• GenBank Accession Number: BC009293
• Gene Symbol: CD7
• Gene ID (NCBI): 924
• ENSEMBL Gene ID: ENSG00000173762
• RRID: AB_2877758
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P09564
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD7, also known as Leu-9 or GP40, is a 40-kDa single-pass type I transmembrane glycoprotein belonging to the immunoglobulin superfamily. CD7 is expressed on thymocytes, T cells, NK cells, and cells in the early stages of T, B, and myeloid cell differentiation (PMID: 10530432). It is one of the earliest antigens to appear on cells of the T-lymphocyte lineage (PMID: 3501369). CD7 plays a significant role in T-cell and T-cell/B-cell interactions during early lymphoid development. It is involved in the regulation of cell signaling and biology, including T-cell activation, proliferation, and the expression of interleukin-2 receptor alpha (IL-2Rα) (PMID: 11485208). CD7 is not only a marker for T-cells but also has functional implications in immune cell interactions and adhesion. It can provide co-stimulatory signals and is associated with CD3 and CD45, participating in T-cell activation (PMID: 7523512).