CD70 Monoclonal antibody, PBS Only

• 

  WB analysis using 67749-1-Ig (same clone as 67749-1-PBS)

  THP-1 cells were subjected to SDS PAGE followed by western blot with 67749-1-Ig (CD70 antibody) at dilution of 1:1000, 2000, 4000 and 8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67749-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 67749-1-Ig (same clone as 67749-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 67749-1-Ig (CD70 antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67749-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 67749-1-Ig (same clone as 67749-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 67749-1-Ig (CD70 antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67749-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human tonsillitis using 67749-1-Ig (same clone as 67749-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using CD70 antibody (67749-1-Ig, Clone: 1A11A10 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67749-1-PBS in a different storage buffer formulation.

CD70 Monoclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 67749-1-PBS

Clone No.1A11A10

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, IF-P, ELISA

Synonyms

1A11A10, CD27 L, CD27 ligand, CD27L, CD27-L

---

Product Information

67749-1-PBS targets CD70 in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28070

  Product name: Recombinant human CD70 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-193 aa of BC000725

  Sequence: MPEEGSGCSVRRRPYGCVLRAALVPLVAGLVICLVVCIQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP

• Full Name: CD70 molecule
• Calculated Molecular Weight: 21 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC000725
• Gene Symbol: CD70
• Gene ID (NCBI): 970
• RRID: AB_2918518
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P32970
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.