CD74 Monoclonal antibody, PBS Only (Detector)

• 

  Cytometric bead array standard curve of MP50646-1

  Cytometric bead array standard curve of MP50646-1, CD74 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 66390-2-PBS. Detection antibody: 66390-3-PBS. Standard:Ag25503. Range: 6.25-200 ng/mL.

CD74 Monoclonal Antibody for Cytometric bead array, Indirect ELISA

Cat No. 66390-3-PBS

Clone No.2B1G4

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Synonyms

Class-II-associated invariant chain peptide, DHLAG, HLADG, HLA-DR antigens-associated invariant chain, Ia antigen-associated invariant chain

---

Product Information

66390-3-PBS targets CD74 as part of a matched antibody pair:

MP50646-1: 66390-2-PBS capture and 66390-3-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25503

  Product name: Recombinant human CD74 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-48 aa of BC018726

  Sequence: MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGA

• Full Name: CD74 molecule, major histocompatibility complex, class II invariant chain
• Calculated Molecular Weight: 34 kDa
• GenBank Accession Number: BC018726
• Gene Symbol: CD74
• Gene ID (NCBI): 972
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G Magarose purification
• UNIPROT ID: P04233
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.