CD74 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86023-5-RR (same clone as 86023-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86023-5-RR (CD74 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86023-5-PBS in a different storage buffer formulation.

CD74 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86023-5-PBS

Clone No.250520B12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Class-II-associated invariant chain peptide, DHLAG, HLADG, HLA-DR antigens-associated invariant chain, Ia antigen-associated invariant chain

---

Product Information

86023-5-PBS targets CD74 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1945

  Product name: Recombinant Human CD74 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-N-rFc

  Tag: N-rFc

  Domain: 73-232 aa of NM_001025159.3

  Sequence: QQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKESLELEDPSSGLGVTKQDLGPVPM

• Full Name: CD74 molecule, major histocompatibility complex, class II invariant chain
• Calculated Molecular Weight: 26 kDa
• Observed Molecular Weight: 37 kDa
• GenBank Accession Number: NM_001025159.3
• Gene Symbol: CD74
• Gene ID (NCBI): 972
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P04233-2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CD74, also known as MHC class II invariant chain Ii or HLA-DR-associated invariant chain, is a non-polymorphic type II transmembrane glycoprotein. CD74 is mainly distributed in B cells, monocytes, Langerhans cells, dendritic cells and thymic epithelial cells, and is also expressed in epithelial cells. CD74 plays a key role in MHC class II antigen processing and also serves as a cell surface receptor for the macrophage cytokine MIF. CD74 plays an important role in cardiovascular diseases such as atherosclerosis, ischemic heart disease, and myocardial hypertrophy.(PMID: 15475450; PMID: 27752708; PMID: 38992165; PMID: 36712241).