• Featured Product
  • KD/KO Validated

CD79a Recombinant monoclonal antibody, PBS Only

CD79a Uni-rAb® Recombinant Antibody for WB, Indirect ELISA
Cat No. 82747-6-PBS
Clone No.230167A8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

230167A8, B-cell antigen receptor complex-associated protein alpha chain, MB 1, MB 1 membrane glycoprotein, MB1

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

82747-6-PBS targets CD79a in WB, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag17924

Product name: Recombinant human CD79A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 33-144 aa of BC113733

Sequence: LWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNRI

Predict reactive species
Full Name CD79a molecule, immunoglobulin-associated alpha
Calculated Molecular Weight 226 aa, 25 kDa
Observed Molecular Weight38-45 kDa
GenBank Accession NumberBC113733
Gene Symbol CD79A
Gene ID (NCBI) 973
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP11912
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CD79a, also named as B-cell antigen receptor complex-associated protein alpha chain or MB-1 membrane glycoprotein, is a 226 amino acid protein, which contains one ITAM domain and one Ig-like C2-type (immunoglobulin-like) domain. CD79A is expressed in B cells and localizes in the cell membrane. CD79A is required in cooperation with CD79B for initiation of the signal transduction cascade activated by binding of antigen to the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. CD79A is also required for BCR surface expression and for efficient differentiation of pro- and pre-B-cells.

Loading...
||
New chat Able
正在加载,请稍候...