Product Information
98217-1-PBS targets CD79b as part of a matched antibody pair:
MP01375-3: 84523-3-PBS capture and 98217-1-PBS detection (validated in Sandwich ELISA)
Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg2113 Product name: Recombinant Mouse CD79B protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 26-158 aa of NM_008339.3 Sequence: VPAMTSSDLPLNFQGSPCSQIWQHPRFAAKKRSSMVKFHCYTNHSGALTWFRKRGSQQPQELVSEEGRIVQTQNGSVYTLTIQNIQYEDNGIYFCKQKCDSANHNVTDSCGTELLVLGFSTLDQLKRRNTLKD Predict reactive species |
| Full Name | CD79B antigen |
| Calculated Molecular Weight | 26 kDa |
| GenBank Accession Number | NM_008339.3 |
| Gene Symbol | Cd79b |
| Gene ID (NCBI) | 15985 |
| RRID | AB_3745884 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P15530 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
CD79 molecule encompasses two transmembrane proteins, CD79a and CD79b, which form a disulfide-linked heterodimer and are members of the immunoglobulin (Ig) gene superfamily (PMID: 2033258; 1375264; 2304550). CD79b molecule (also known as B29, IGB, AGM6, and Igbeta) is expressed almost exclusively on B cells and B-cell neoplasms, influencing antigen internalization and increasing antigen presentation efficiency (PMID: 7552998). CD79b mutation could be a key biomarker for DLBCL disease progression (PMID: 36182550).
