CD81 Recombinant monoclonal antibody

• 

  WB analysis of HCT 116 using 84644-1-RR

  WB result of CD81 antibody (84644-1-RR; 1:1000; room temperature for 1.5 hours) with wild-type and CD81 knockout HCT 116 cells.

• 

  WB analysis using 84644-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 84644-1-RR (CD81 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of Jurkat using 84644-1-RR

  Immunofluorescent analysis of (4% PFA) fixed Jurkat cells using CD81 antibody (84644-1-RR, Clone: 241722B8 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  Affinity and Kinetic Characterization of 84644-1-RR

  Biolayer interferometry (BLl) kinetic assays of 84644-1-RR against Human CD81 were performed. The affinity constant is 0.602 nM.

• Featured Product
• KD/KO Validated

CD81 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 84644-1-RR

Clone No.241722B8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

241722B8, 26 kDa cell surface protein TAPA-1, CD81 antigen, CD81 molecule, S5.7

---

Tested Applications

• Positive WB detected in: Raji cells, HCT 116 cells, Ramos cells, Daudi cells, Jurkat cells, THP-1 cells, K-562 cells
• Positive IF/ICC detected in: Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84644-1-RR targets CD81 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1036

  Product name: recombinant human CD81 protein

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: N-6*His

  Domain: 113-201 aa of NM_004356.4

  Sequence: FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK

• Full Name: CD81 molecule
• Calculated Molecular Weight: 26 kDa
• Observed Molecular Weight: 20-25 kDa
• GenBank Accession Number: NM_004356.4
• Gene Symbol: CD81
• Gene ID (NCBI): 975
• ENSEMBL Gene ID: ENSG00000110651
• RRID: AB_3672103
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P60033
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD81 (also known as TAPA1 or TSPAN28) is a membrane protein of the tetraspanin superfamily, which are characterized by the presence of four conserved transmembrane regions. Many of these members are expressed on leukocytes and have been implicated in signal transduction, cell-cell interactions, and cellular activation and development. CD81 is involved in signal transduction and cell adhesion in the immune system (PMID: 9597125). CD81 has also been identified as an essential receptor for HCV (hepatitis C virus) (PMID: 21428934).