Anti-Mouse CD83 Rabbit Recombinant Antibody

• 

  FC experiment of mouse splenocytes using 98119-1-RR

  1x10^6 untreated or LPS-treated mouse splenocytes were surface stained with 0.25 ug Anti-Mouse CD83 Rabbit Recombinant Antibody (98119-1-RR, Clone: 241002B7) and PE-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). Cells were not fixed.

• 

  FC experiment of mouse splenocytes using 98119-1-RR

  1x10^6 LPS-treated mouse splenocytes were surface stained with 0.25 ug Anti-Mouse CD83 Rabbit Recombinant Antibody (98119-1-RR, Clone: 241002B7) (red) or 0.25 ug Isotype Control (blue), and PE-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). 1x10^6 untreated mouse splenocytes were surface stained with 0.25 ug Anti-Mouse CD83 Rabbit Recombinant Antibody (98119-1-RR, Clone: 241002B7) (black, dashed), and PE-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). Cells were not fixed.

• 

  Affinity and Kinetic Characterization of 98119-1-RR

  Biolayer interferometry (BLl) kinetic assays of 98119-1-RR against Mouse CD83 were performed. The affinity constant is 0.199 nM.

CD83 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98119-1-RR

Clone No.241002B7

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

241002B7, CD83 antigen, mCD83

---

Tested Applications

• Positive FC detected in: LPS treated mouse splenocytes

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in 100 μl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

98119-1-RR targets CD83 in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1387

  Product name: Recombinant Mouse CD83 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 22-133 aa of NM_009856.3

  Sequence: MREVTVACSETADLPCTAPWDPQLSYAVSWAKVSESGTESVELPESKQNSSFEAPRRRAYSLTIQNTTICSSGTYRCALQELGGQRNLSGTVVLKVTGCPKEATESTFRKYR

• Full Name: CD83 antigen
• Calculated Molecular Weight: 21 kDa
• GenBank Accession Number: NM_009856.3
• Gene Symbol: Cd83
• Gene ID (NCBI): 12522
• RRID: AB_3672266
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: O88324
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Background Information

CD83 is a member of the immunoglobulin (Ig) superfamily, consisting of an extracellular V-type Ig-like domain, a transmembrane domain, and a cytoplasmic tail. CD83 is one of the most prominent markers for fully matured dendritic cells (DCs) (PMID: 17334966). It is also found on the surface of other activated hematopoietic cells, including lymphocytes, monocytes, macrophages, and neutrophils (PMID: 31231400; 17334966). CD83 regulates the maturation, activation, and homeostasis of numerous immune cells (PMID: 31231400; 32362900). CD83 can also expressed as a soluble form. Soluble CD83 can bind to DCs and inhibit their maturation (PMID: 17334966; 12403928).