CD84 Polyclonal antibody

• 

  WB analysis of Raji using 12566-1-AP

  Raji cells were subjected to SDS PAGE followed by western blot with 12566-1-AP (CD84 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse thymus using 12566-1-AP

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 12566-1-AP (CD84 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 12566-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 12566-1-AP (CD84 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of U-937 using 12566-1-AP

  U-937 cells were subjected to SDS PAGE followed by western blot with 12566-1-AP (CD84 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse spleen using 12566-1-AP

  mouse spleen tissue were subjected to SDS PAGE followed by western blot with 12566-1-AP (CD84 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

CD84 Polyclonal Antibody for WB, ELISA

Cat No. 12566-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

CD84 molecule, Cell surface antigen MAX.3, hCD84, Hly9 beta, Hly9-beta

---

Tested Applications

• Positive WB detected in: Raji cells, mouse liver tissue, mouse spleen tissue, mouse thymus tissue, U-937 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

12566-1-AP targets CD84 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3192

  Product name: Recombinant human CD84 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 23-328 aa of BC020063

  Sequence: DSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSETAPVVTVTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTTTKRYNLQIYRRLGKPKITQSLMASVNSTCNVTLTCSVEKEEKNVTYNWSPLGEEGNVLQIFQTPEDQELTYTCTAQNPVSNNSDSISARQLCADIAMGFRTHHTGLLSVLAMFFLLVLILSSVFLFRLFKRRQDAASKKTIYTYIMASRNTQPAESRIYDEILQSKVLPSKEEPVNTVYSEVQFADKMGKASTQDSKPPGTSSYEIVI

• Full Name: CD84 molecule
• Calculated Molecular Weight: 345 aa, 39 kDa
• Observed Molecular Weight: 45 kDa, 66-70 kDa
• GenBank Accession Number: BC020063
• Gene Symbol: CD84
• Gene ID (NCBI): 8832
• RRID: AB_10638482
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UIB8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Arthritis Rheum; Decreased microRNA-142-3p/5p expression causes CD4+ T cell activation and B cell hyperstimulation in systemic lupus erythematosus.; Authors - Ding Shu S