CD86 Recombinant monoclonal antibody

• 

  WB analysis using 82882-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 82882-1-RR (CD86 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat thymus using 82882-1-RR

  rat thymus tissue were subjected to SDS PAGE followed by western blot with 82882-1-RR (CD86 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

CD86 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 82882-1-RR

Clone No.4M12

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

Human, Rat and More (1)

Applications

WB, ELISA

Synonyms

Activation B7 2 antigen, B7 2, B70, BU63, CD28LG2, CD86, CD86 molecule, CTLA 4 counter receptor B7.2, FUN 1, LAB72

---

Tested Applications

• Positive WB detected in: Raji cells, rat thymus tissue, Daudi cells, Ramos cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

82882-1-RR targets CD86 in WB, ELISA applications and shows reactivity with Human, Rat samples.

• Tested Reactivity: Human, Rat
• Cited Reactivity: rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag4063

  Product name: Recombinant human CD86 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 27-247 aa of BC040261

  Sequence: KIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGIMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIP

• Full Name: CD86 molecule
• Calculated Molecular Weight: 329 aa, 38 kDa
• Observed Molecular Weight: 75 kDa
• GenBank Accession Number: BC040261
• Gene Symbol: CD86
• Gene ID (NCBI): 942
• ENSEMBL Gene ID: ENSG00000114013
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P42081
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD86 (also known as B7.2) is a costimulatory molecule belonging to the immunoglobulin superfamily. Primarily expressed on antigen-presenting cells (APCs), including B cells, dendritic cells, and macrophages, CD86 is the ligand for two proteins at the cell surface of T cells, CD28 antigen and cytotoxic T-lymphocyte-associated protein 4. Binding of CD86 with CD28 antigen is a costimulatory signal for activation of the T-cell. Binding of CD86 with cytotoxic T-lymphocyte-associated protein 4 negatively regulates T-cell activation and diminishes the immune response.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	Int Immunopharmacol; Preventive and therapeutic effects of Tanshinone IIA on spinal cord injury without radiographic abnormality by regulating microglial phenotype polarization; Authors - Luchun Xu