Mouse CD86 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83213-5-RR (same clone as 83213-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83213-5-RR (CD86 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83213-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83213-5-RR

  Biolayer interferometry (BLl) kinetic assays of 83213-5-RR against Mouse CD86 were performed. The affinity constant is 97.9 nM.

CD86 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 83213-5-PBS

Clone No.230476A1

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, ELISA

Synonyms

230476A1, B7, B7 2, B7.2, B70

---

Product Information

83213-5-PBS targets CD86 in WB, ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0802

  Product name: Recombinant Mouse CD86 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 24-245 aa of NM_019388

  Sequence: VSVETQAYFNGTAYLPCPFTKAQNISLSELVVFWQDQQKLVLYEHYLGTEKLDSVNAKYLGRTSFDRNNWTLRLHNVQIKDMGSYDCFIQKKPPTGSIILQQTLTELSVIANFSEPEIKLAQNVTGNSGINLTCTSKQGHPKPKKMYFLITNSTNEYGDNMQISQDNVTELFSISNSLSLSFPDGVWHMTVVCVLETESMKISSKPLNFTQEFPSPQTYWKE

• Full Name: CD86 antigen
• Calculated Molecular Weight: 35 kDa
• Observed Molecular Weight: 65 kDa
• GenBank Accession Number: NM_019388
• Gene Symbol: Cd86
• Gene ID (NCBI): 12524
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P42082-1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CD86 (also known as B7-2) is a costimulatory molecule belonging to the immunoglobulin superfamily. Primarily expressed on antigen-presenting cells (APCs), including B cells, dendritic cells, and macrophages, CD86 is the ligand for two proteins at the cell surface of T cells, CD28 antigen and CTLA-4. Binding of CD86 with CD28 antigen is a costimulatory signal for activation of the T-cell. Binding of CD86 with CTLA-4 negatively regulates T-cell activation and diminishes the immune response. (PMID: 7513726; 1847722; 11029388; 27591335)