Anti-Mouse CD86 Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• Anti-Mouse CD86 Rabbit Recombinant Antibody (98025-1-RR)

CD86 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98025-1-RR Copied!

Clone No. 230476B8

Publications (24)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

IF, FC

Synonyms

230476B8, B7, B7 2, B7.2, B70

• 

  FC experiment of mouse splenocytes using 98025-1-RR

  1x10^6 unstimulated or LPS stimulated mouse splenocytes were surface stained with 0.25 ug Anti-Mouse CD86 Rabbit Recombinant Antibody (98025-1-RR, Clone:230476B8) and PE-Conjugated AffiniPure Goat Anti-Rabbit IgG (H+L). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of mouse splenocytes using 98025-1-RR

  1x10^6 unstimulated (black) or LPS stimulated mouse splenocytes were surface stained with 0.25 ug Anti-Mouse CD86 Rabbit Recombinant Antibody (98025-1-RR, Clone:230476B8) and PE-Conjugated AffiniPure Goat Anti-Rabbit IgG (H+L) (red), or 0.25 ug Isotype Control (blue). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity and Kinetic Characterization of 98025-1-RR

  Biolayer interferometry (BLl) kinetic assays of 98025-1-RR against Mouse CD86 were performed. The affinity constant is 25.4 nM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CD86 in ?

Chat with Able

---

Tested Applications

• Positive FC detected in: LPS treated mouse splenocytes

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in 100 μl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

98025-1-RR targets CD86 in IF, FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0802

  Product name: Recombinant Mouse CD86 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 24-245 aa of NM_019388

  Sequence: VSVETQAYFNGTAYLPCPFTKAQNISLSELVVFWQDQQKLVLYEHYLGTEKLDSVNAKYLGRTSFDRNNWTLRLHNVQIKDMGSYDCFIQKKPPTGSIILQQTLTELSVIANFSEPEIKLAQNVTGNSGINLTCTSKQGHPKPKKMYFLITNSTNEYGDNMQISQDNVTELFSISNSLSLSFPDGVWHMTVVCVLETESMKISSKPLNFTQEFPSPQTYWKE

• Full Name: CD86 antigen
• Calculated Molecular Weight: 35 kDa
• GenBank Accession Number: NM_019388
• Gene Symbol: Cd86
• Gene ID (NCBI): 12524
• RRID: AB_3672169
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P42082-1
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2-8°C. Stable for one year after shipment.

Background Information

CD86 (also known as B7-2) is a costimulatory molecule belonging to the immunoglobulin superfamily. Primarily expressed on antigen-presenting cells (APCs), including B cells, dendritic cells, and macrophages, CD86 is the ligand for two proteins at the cell surface of T cells, CD28 antigen and CTLA-4. Binding of CD86 with CD28 antigen is a costimulatory signal for activation of the T-cell. Binding of CD86 with CTLA-4 negatively regulates T-cell activation and diminishes the immune response. (PMID: 7513726; 1847722; 11029388; 27591335)

Publications

What published studies show

The Anti-Mouse CD86 Rabbit Recombinant Antibody (230476B8), catalog number 98025-1-RR, has 24 citations. These appear in journals including Bioactive Materials, Journal of Nanobiotechnology, Phytomedicine, Materials Today Bio, International Journal of Nanomedicine, International Journal of Biological Macromolecules, ACS Applied Materials & Interfaces, Journal of Ethnopharmacology, Biomaterials Advances, Biomaterials Science, Biological Direct, Food Science & Nutrition, Journal of Materials Science: Materials in Medicine, Acta Biochimica et Biophysica Sinica, International Journal of Clinical Oncology, Biochemical and Biophysical Research Communications, International Immunopharmacology, and Materials Horizons. Research fields span wound healing, bone regeneration, cancer immunotherapy, and macrophage polarization.

Automatically generated from the 24 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	FC	Bioact Mater; Engineered polypeptide cascade-release platform restores macrophage plasticity for accelerated diabetic wound healing.; Authors - Hao Xia
		Bioact Mater; Multifunctional DNA hydrogels with light-triggered gas-therapy and controlled G-Exos release for infected wound healing.; Authors - Yuyun Ye
mouse	FC	Bioact Mater; A near-infrared regulated programmable multi-mode periosteum scaffold for sequential healing of infected bone defects.; Authors - Ying Yin
mouse	FC	J Nanobiotechnology; Extracellular vesicles derived from Kaempferia Galanga L. show promise for targeted oral therapy in the treatment of ulcerative colitis.; Authors - Lizhen Lin
		Phytomedicine; Daphnetin alleviates influenza pneumonia by enhancing chaperone-mediated autophagy of KEAP1 through Heat shock cognate 71 kDa protein.; Authors - Jian Wang
mouse	FC	Mater Today Bio; Mitochondria-targeted cuproptosis-driven nanoplatform for synergistic photothermal/chemodynamic therapy and systemic antitumor immunotherapy.; Authors - Hui Zhang