CD8a Recombinant monoclonal antibody, PBS Only

• 

  IHC staining of human tonsillitis using 86063-2-RR (same clone as 86063-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 86063-2-RR (CD8a antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86063-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 86063-2-RR (same clone as 86063-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 86063-2-RR (CD8a antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86063-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 86063-2-RR (same clone as 86063-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 86063-2-RR (CD8a antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86063-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 86063-2-RR (same clone as 86063-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 86063-2-RR (CD8a antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86063-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 86063-2-RR (same clone as 86063-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 86063-2-RR (CD8a antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86063-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 86063-2-RR (same clone as 86063-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 86063-2-RR (CD8a antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86063-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human rectal cancer using 86063-2-RR (same clone as 86063-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human rectal cancer tissue slide using 86063-2-RR (CD8a antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86063-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human rectal cancer using 86063-2-RR (same clone as 86063-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human rectal cancer tissue slide using 86063-2-RR (CD8a antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86063-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human hepatocellular cancer using 86063-2-RR (same clone as 86063-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human hepatocellular cancer slide using 86063-2-RR (CD8a antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86063-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human hepatocellular cancer using 86063-2-RR (same clone as 86063-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human hepatocellular cancer slide using 86063-2-RR (CD8a antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86063-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 86063-2-RR (same clone as 86063-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 86063-2-RR (CD8a antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86063-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 86063-2-RR (same clone as 86063-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 86063-2-RR (CD8a antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86063-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 86063-2-RR (same clone as 86063-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 86063-2-RR (CD8a antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86063-2-PBS in a different storage buffer formulation.

• 

  IF Staining of human tonsillitis using 86063-2-RR (same clone as 86063-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using CD8a antibody (86063-2-RR, Clone: 243018F10 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 86063-2-PBS in a different storage buffer formulation.

• 

  IF Staining of human tonsillitis using 86063-2-RR (same clone as 86063-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using CD8a antibody (86063-2-RR, Clone: 243018F10 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 86063-2-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 86063-2-RR

  Biolayer interferometry (BLl) kinetic assays of 86063-2-RR against Human CD8a were performed. The affinity constant is 13.2 nM.

CD8a Uni-rAb^® Recombinant Antibody for IHC, IF/ICC, Indirect ELISA

Cat No. 86063-2-PBS

Clone No.243018F10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF/ICC, Indirect ELISA

Synonyms

CD8, CD8a molecule, Leu2, MAL, p32

---

Product Information

86063-2-PBS targets CD8a in IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0819

  Product name: Recombinant Human CD8a protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 22-182 aa of NM_001145873.1

  Sequence: SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD

• Full Name: CD8a molecule
• Calculated Molecular Weight: 26 kDa
• GenBank Accession Number: NM_001145873.1
• Gene Symbol: CD8A
• Gene ID (NCBI): 925
• ENSEMBL Gene ID: ENSG00000153563
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P01732-1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CD8 is a transmembrane glycoprotein that is predominantly expressed on the surface of cytotoxic T cells, and can also be found on natural killer cells, cortical thymocytes, and dendritic cells. CD8 serves as a co-receptor for the T cell receptor (TCR). Both CD8 and TCR recognize antigens displayed by an antigen presenting cell (APC) in the context of class I MHC molecules. CD8 plays a role in T cell development and activation of mature T cells. This antibody is raised against 22-182 aa of human CD8a, the alpha chain of CD8 molecule.